DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lrrc32

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_006229808.1 Gene:Lrrc32 / 293135 RGDID:1309087 Length:690 Species:Rattus norvegicus


Alignment Length:424 Identity:89/424 - (20%)
Similarity:150/424 - (35%) Gaps:157/424 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IPTMIIEPLK---NLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHI---MALDQ-------- 224
            :.::::.||.   .|..:.:..:::..::...|..||:||.:.|.:|.:   |||:.        
  Rat    89 LQSILVSPLSFYTALRHLDLSDNEISFLQPGVFQALPYLEHLNLAHNRLAAGMALNSGGLGRLPL 153

  Fly   225 ----DAFANHI-------------RLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHE 272
                |...|.:             |||.|:|..|.:..:.|:.|..:|..|:|.|::|.:..:.:
  Rat   154 VVSLDLSGNSLHGSLVERLLGEAPRLRTLSLAENSLTRLARHTFWGMPAMEQLDLHSNVLMDIED 218

  Fly   273 GLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNN----------------------- 314
            |.|..:.:||.|||:.|.:..::.   ..|..|.||.|:.|:                       
  Rat   219 GAFEALPQLTHLNLSRNSLTCISD---FSLQQLQVLDLSCNSIETFQTAPESQAQFQLAWLDLRE 280

  Fly   315 ---LNFIGDTVFAEL-----------------------------WSLS----------------- 330
               |:|....:|..|                             ||.|                 
  Rat   281 NKLLHFPDLAMFPRLIYLNVSNNLIQLPTGLPQDSEDLHAPSEGWSASLLSNPSRNASIHPLSQL 345

  Fly   331 -ELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYT 394
             .|:|..|.||.:....|:.|.:|:.|||..|.|:..:.......|.|:.:::..|.||.|...|
  Rat   346 LNLDLSYNEIELVPAGFLEHLTSLRFLNLSRNCLRSFEARRAGSLPCLVLLDLSHNVLEALELGT 410

  Fly   395 FQPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRD----------SLEDLHCTLQ 449
                  .::.|...||:.||                     .||:          ||:.|:  ||
  Rat   411 ------KVLGSLKTLLLQDN---------------------TLRELPPYTFAGLASLQRLN--LQ 446

  Fly   450 EPKLSHF---VDPVPPTILD--------VLNIGG 472
            ..::|..   .:|.||..:|        .||:.|
  Rat   447 GNQVSPCGGQAEPGPPGCVDFSGIPTLHFLNMAG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 36/147 (24%)
LRR_8 183..243 CDD:290566 19/90 (21%)
leucine-rich repeat 185..208 CDD:275380 3/22 (14%)
leucine-rich repeat 209..232 CDD:275380 9/50 (18%)
LRR_RI <225..416 CDD:238064 61/276 (22%)
LRR_8 232..291 CDD:290566 21/58 (36%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
LRR_8 304..363 CDD:290566 24/131 (18%)
leucine-rich repeat 305..328 CDD:275380 9/77 (12%)
leucine-rich repeat 329..352 CDD:275380 8/40 (20%)
LRR_8 352..416 CDD:290566 18/63 (29%)
leucine-rich repeat 353..376 CDD:275380 6/22 (27%)
LRRCT 414..>450 CDD:214507 7/45 (16%)
Lrrc32XP_006229808.1 LRR_8 80..137 CDD:290566 10/47 (21%)
LRR_RI 82..305 CDD:238064 46/218 (21%)
leucine-rich repeat 82..102 CDD:275380 2/12 (17%)
leucine-rich repeat 103..126 CDD:275380 3/22 (14%)
leucine-rich repeat 127..153 CDD:275380 7/25 (28%)
leucine-rich repeat 154..178 CDD:275380 2/23 (9%)
LRR_8 177..237 CDD:290566 21/59 (36%)
leucine-rich repeat 179..202 CDD:275380 7/22 (32%)
leucine-rich repeat 203..226 CDD:275380 6/22 (27%)
LRR_8 225..283 CDD:290566 12/60 (20%)
leucine-rich repeat 227..247 CDD:275380 7/22 (32%)
leucine-rich repeat 248..272 CDD:275380 5/23 (22%)
leucine-rich repeat 273..294 CDD:275380 3/20 (15%)
LRR_8 343..403 CDD:290566 16/59 (27%)
leucine-rich repeat 345..368 CDD:275380 7/22 (32%)
LRR_RI 389..605 CDD:238064 27/121 (22%)
LRR_8 393..450 CDD:290566 18/85 (21%)
leucine-rich repeat 393..415 CDD:275380 6/27 (22%)
leucine-rich repeat 416..439 CDD:275380 6/43 (14%)
leucine-rich repeat 440..472 CDD:275380 9/33 (27%)
leucine-rich repeat 473..494 CDD:275380 3/8 (38%)
leucine-rich repeat 496..520 CDD:275380
leucine-rich repeat 521..543 CDD:275380
LRR_8 542..601 CDD:290566
leucine-rich repeat 544..565 CDD:275380
leucine-rich repeat 566..587 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.