Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006229808.1 | Gene: | Lrrc32 / 293135 | RGDID: | 1309087 | Length: | 690 | Species: | Rattus norvegicus |
Alignment Length: | 424 | Identity: | 89/424 - (20%) |
---|---|---|---|
Similarity: | 150/424 - (35%) | Gaps: | 157/424 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 IPTMIIEPLK---NLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHI---MALDQ-------- 224
Fly 225 ----DAFANHI-------------RLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHE 272
Fly 273 GLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNN----------------------- 314
Fly 315 ---LNFIGDTVFAEL-----------------------------WSLS----------------- 330
Fly 331 -ELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYT 394
Fly 395 FQPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRD----------SLEDLHCTLQ 449
Fly 450 EPKLSHF---VDPVPPTILD--------VLNIGG 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 36/147 (24%) |
LRR_8 | 183..243 | CDD:290566 | 19/90 (21%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 9/50 (18%) | ||
LRR_RI | <225..416 | CDD:238064 | 61/276 (22%) | ||
LRR_8 | 232..291 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 304..363 | CDD:290566 | 24/131 (18%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 9/77 (12%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 8/40 (20%) | ||
LRR_8 | 352..416 | CDD:290566 | 18/63 (29%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 414..>450 | CDD:214507 | 7/45 (16%) | ||
Lrrc32 | XP_006229808.1 | LRR_8 | 80..137 | CDD:290566 | 10/47 (21%) |
LRR_RI | 82..305 | CDD:238064 | 46/218 (21%) | ||
leucine-rich repeat | 82..102 | CDD:275380 | 2/12 (17%) | ||
leucine-rich repeat | 103..126 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 127..153 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 154..178 | CDD:275380 | 2/23 (9%) | ||
LRR_8 | 177..237 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 203..226 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 225..283 | CDD:290566 | 12/60 (20%) | ||
leucine-rich repeat | 227..247 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 248..272 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 273..294 | CDD:275380 | 3/20 (15%) | ||
LRR_8 | 343..403 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 345..368 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 389..605 | CDD:238064 | 27/121 (22%) | ||
LRR_8 | 393..450 | CDD:290566 | 18/85 (21%) | ||
leucine-rich repeat | 393..415 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 416..439 | CDD:275380 | 6/43 (14%) | ||
leucine-rich repeat | 440..472 | CDD:275380 | 9/33 (27%) | ||
leucine-rich repeat | 473..494 | CDD:275380 | 3/8 (38%) | ||
leucine-rich repeat | 496..520 | CDD:275380 | |||
leucine-rich repeat | 521..543 | CDD:275380 | |||
LRR_8 | 542..601 | CDD:290566 | |||
leucine-rich repeat | 544..565 | CDD:275380 | |||
leucine-rich repeat | 566..587 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45617 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |