DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Elfn1

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001099383.1 Gene:Elfn1 / 288512 RGDID:1308787 Length:829 Species:Rattus norvegicus


Alignment Length:228 Identity:57/228 - (25%)
Similarity:89/228 - (39%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALD 348
            |.|..|:|..:........|||..|.||:|.:.:|.|..|:..::|..|:|..||:..::|..|.
  Rat    65 LRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQLGYNRLRNLTEGMLR 129

  Fly   349 GLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSD 413
            ||:.|:.|.|:.||::.:........|.:::|::..|:::.|...||..:     ...|...:..
  Rat   130 GLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGL-----TKLSVCEIYS 189

  Fly   414 NKFICDCR----LQWIFELKNRT-----------------------RHLQLRDSLEDLH--CT-- 447
            |.|.|.|.    |:|:....|.|                       ||...|..|..|.  ||  
  Rat   190 NPFYCSCELLGFLRWLAAFTNATQTHDRVQCESPPVYAGYFLLGQGRHGHQRSILSKLQSVCTEG 254

  Fly   448 ------LQEPK-------LSHFVDPVPPTILDV 467
                  |..|:       ..|...|.||...|:
  Rat   255 SYTAEVLGPPRPVPGRSQPGHSPPPPPPEPSDM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 53/218 (24%)
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..256 CDD:275380
leucine-rich repeat 257..280 CDD:275380
leucine-rich repeat 281..304 CDD:275380 4/19 (21%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
leucine-rich repeat 329..352 CDD:275380 9/22 (41%)
leucine-rich repeat 353..376 CDD:275380 5/22 (23%)
Elfn1NP_001099383.1 LRR 40..>190 CDD:443914 35/129 (27%)
leucine-rich repeat 65..85 CDD:275378 4/19 (21%)
LRR_8 85..144 CDD:404697 22/58 (38%)
leucine-rich repeat 86..109 CDD:275378 8/22 (36%)
leucine-rich repeat 110..133 CDD:275378 9/22 (41%)
leucine-rich repeat 134..157 CDD:275378 5/22 (23%)
leucine-rich repeat 158..171 CDD:275378 2/12 (17%)
LRRCT 190..>228 CDD:214507 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.