Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099383.1 | Gene: | Elfn1 / 288512 | RGDID: | 1308787 | Length: | 829 | Species: | Rattus norvegicus |
Alignment Length: | 228 | Identity: | 57/228 - (25%) |
---|---|---|---|
Similarity: | 89/228 - (39%) | Gaps: | 49/228 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 LNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALD 348
Fly 349 GLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSD 413
Fly 414 NKFICDCR----LQWIFELKNRT-----------------------RHLQLRDSLEDLH--CT-- 447
Fly 448 ------LQEPK-------LSHFVDPVPPTILDV 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 3/6 (50%) |
LRR_8 | 183..243 | CDD:290566 | |||
leucine-rich repeat | 185..208 | CDD:275380 | |||
leucine-rich repeat | 209..232 | CDD:275380 | |||
LRR_RI | <225..416 | CDD:238064 | 36/131 (27%) | ||
LRR_8 | 232..291 | CDD:290566 | 3/6 (50%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | |||
leucine-rich repeat | 257..280 | CDD:275380 | |||
leucine-rich repeat | 281..304 | CDD:275380 | 4/19 (21%) | ||
LRR_8 | 304..363 | CDD:290566 | 22/58 (38%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 352..416 | CDD:290566 | 13/63 (21%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 5/22 (23%) | ||
LRRCT | 414..>450 | CDD:214507 | 16/72 (22%) | ||
Elfn1 | NP_001099383.1 | LRR | <44..>186 | CDD:227223 | 35/125 (28%) |
leucine-rich repeat | 65..85 | CDD:275378 | 4/19 (21%) | ||
LRR_8 | 85..144 | CDD:404697 | 22/58 (38%) | ||
leucine-rich repeat | 86..109 | CDD:275378 | 8/22 (36%) | ||
leucine-rich repeat | 110..133 | CDD:275378 | 9/22 (41%) | ||
leucine-rich repeat | 134..157 | CDD:275378 | 5/22 (23%) | ||
leucine-rich repeat | 158..171 | CDD:275378 | 2/12 (17%) | ||
LRRCT | 190..>228 | CDD:214507 | 8/37 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334977 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |