DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lgi4

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_653139.2 Gene:Lgi4 / 243914 MGIID:2180197 Length:537 Species:Mus musculus


Alignment Length:264 Identity:70/264 - (26%)
Similarity:107/264 - (40%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISER 345
            |..|:|....::.|.:..|..:.:|::|..|.|..:.|....|..|..|..|.::||:|..||:.
Mouse    54 LLSLSLVRMGVSRLKAGSFLKMPSLHLLLFTSNTFSVIEGDAFIGLSYLQYLFIEDNKIGSISKN 118

  Fly   346 ALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELL 410
            ||.||.:|..|:|.||.|:.:...|.||             |||||....:              
Mouse   119 ALRGLRSLTHLSLANNHLEALPRFLFRG-------------LETLTHVDLR-------------- 156

  Fly   411 VSDNKFICDCRLQWIFELKNRTRHLQLRDSLEDLHC----TLQEPKLSHFVDP----VPPTILDV 467
              .|.|.||||:.|:.:...     .:..|:....|    .:.:.:|:| :||    ...|.|..
Mouse   157 --GNPFQCDCRVLWLLQWMP-----TVNASVGTGACAGPPAVAQIQLNH-LDPKKFKCRATELSW 213

  Fly   468 LNIGGFTAIGSNSASMGGVGNSVVGSSYSG----LTMDDSRKHLGSRSRQALRGQRQFASSAENV 528
            |...|.:|:...|.|..|..:.|:...::|    |..|        .|.|..|.:.:.  ||.:|
Mouse   214 LQTVGESALSVESFSYQGEPHMVLAQPFAGRCLILVWD--------YSLQRFRPEEEL--SAPSV 268

  Fly   529 VESK 532
            |..|
Mouse   269 VSCK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 3/9 (33%)
LRR_8 183..243 CDD:290566
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
LRR_RI <225..416 CDD:238064 38/134 (28%)
LRR_8 232..291 CDD:290566 3/9 (33%)
leucine-rich repeat 233..256 CDD:275380
leucine-rich repeat 257..280 CDD:275380
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
LRR_8 304..363 CDD:290566 23/58 (40%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
leucine-rich repeat 329..352 CDD:275380 11/22 (50%)
LRR_8 352..416 CDD:290566 15/63 (24%)
leucine-rich repeat 353..376 CDD:275380 9/22 (41%)
LRRCT 414..>450 CDD:214507 9/39 (23%)
Lgi4NP_653139.2 LRR 1 53..74 5/19 (26%)
leucine-rich repeat 54..77 CDD:275378 5/22 (23%)
LRR_8 76..136 CDD:290566 23/59 (39%)
LRR 2 77..98 6/20 (30%)
leucine-rich repeat 78..101 CDD:275378 7/22 (32%)
LRR 3 101..122 9/20 (45%)
LRR_4 102..140 CDD:289563 17/37 (46%)
leucine-rich repeat 102..125 CDD:275378 11/22 (50%)
LRR 4 125..146 7/20 (35%)
leucine-rich repeat 126..149 CDD:275378 10/35 (29%)
leucine-rich repeat 150..162 CDD:275378 4/27 (15%)
LRRCT 158..206 CDD:214507 13/53 (25%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 210..252 11/49 (22%)
EPTP <220..251 CDD:281697 7/30 (23%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 256..298 6/19 (32%)
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 302..349
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 351..394
EPTP 351..392 CDD:281697
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 396..439
EPTP 396..438 CDD:281697
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 441..483
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 487..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.