| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001371115.1 | Gene: | Elfn1 / 243312 | MGIID: | 2442479 | Length: | 828 | Species: | Mus musculus |
| Alignment Length: | 228 | Identity: | 57/228 - (25%) |
|---|---|---|---|
| Similarity: | 89/228 - (39%) | Gaps: | 49/228 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 284 LNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALD 348
Fly 349 GLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSD 413
Fly 414 NKFICDCR----LQWIFELKNRT-----------------------RHLQLRDSLEDLH--CT-- 447
Fly 448 ------LQEPK-------LSHFVDPVPPTILDV 467 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 3/6 (50%) |
| LRR_8 | 183..243 | CDD:290566 | |||
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | |||
| LRR_RI | <225..416 | CDD:238064 | 36/131 (27%) | ||
| LRR_8 | 232..291 | CDD:290566 | 3/6 (50%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | |||
| leucine-rich repeat | 257..280 | CDD:275380 | |||
| leucine-rich repeat | 281..304 | CDD:275380 | 4/19 (21%) | ||
| LRR_8 | 304..363 | CDD:290566 | 22/58 (38%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 352..416 | CDD:290566 | 13/63 (21%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 5/22 (23%) | ||
| LRRCT | 414..>450 | CDD:214507 | 16/72 (22%) | ||
| Elfn1 | NP_001371115.1 | LRR 1 | 61..82 | 4/16 (25%) | |
| leucine-rich repeat | 65..85 | CDD:275378 | 4/19 (21%) | ||
| LRR_8 | 85..144 | CDD:404697 | 22/58 (38%) | ||
| LRR 2 | 85..106 | 9/20 (45%) | |||
| leucine-rich repeat | 86..109 | CDD:275378 | 8/22 (36%) | ||
| LRR 3 | 109..130 | 7/20 (35%) | |||
| leucine-rich repeat | 110..133 | CDD:275378 | 9/22 (41%) | ||
| LRR_8 | 132..182 | CDD:404697 | 11/54 (20%) | ||
| LRR 4 | 133..154 | 5/20 (25%) | |||
| leucine-rich repeat | 134..157 | CDD:275378 | 5/22 (23%) | ||
| LRR 5 | 157..178 | 5/20 (25%) | |||
| leucine-rich repeat | 158..171 | CDD:275378 | 2/12 (17%) | ||
| LRRCT | 190..>228 | CDD:214507 | 8/37 (22%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 258..293 | 7/30 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 627..674 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 697..731 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167831246 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||