DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lrit3

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 / 242235 MGIID:2685267 Length:681 Species:Mus musculus


Alignment Length:257 Identity:64/257 - (24%)
Similarity:102/257 - (39%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LPLCERLFLN----NNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNN 314
            |.||..|.:|    |..:.|            :.|.:....:..|.:|.|..|..|..|.|..|:
Mouse    40 LVLCNDLDMNEVPANFPVDT------------SKLRIEKTVVRRLPAEAFYYLVELQYLWLAYNS 92

  Fly   315 LNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLS 379
            :..|..:.|..|..|.||.||.|.:......:|..:..|:||:|.||.:..:.|..:|....|..
Mouse    93 VASIETSSFYNLRQLHELRLDGNSLTAFPWVSLLDMPHLRTLDLHNNRIASVPNEAVRYLRNLTC 157

  Fly   380 INVQANKLETLTFYTFQPIMDNLVNSTSELLVS-----------------DNKFICDCRLQWIFE 427
            :::.:|:|.||.        .:.::|.|.|.|:                 ||.:.|||.:..:.|
Mouse   158 LDLSSNRLTTLP--------PDFLDSWSHLAVTPSRSPDFPPRRIILGLQDNPWFCDCHISKVIE 214

  Fly   428 LKNRTRH-LQLRDSLEDLHCT---------LQEPKLSHFVDPVPPTILDVLNIGGFTAIGSN 479
            |...|.| :.|.|.|  :.|:         .|..:|...:.  |..::....|  .:|:|||
Mouse   215 LSKVTDHAVVLLDPL--MVCSEPERFQGILFQRVELEKCLK--PSVMMSATKI--TSALGSN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 8/40 (20%)
LRR_8 183..243 CDD:290566
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
LRR_RI <225..416 CDD:238064 45/182 (25%)
LRR_8 232..291 CDD:290566 8/40 (20%)
leucine-rich repeat 233..256 CDD:275380 1/1 (100%)
leucine-rich repeat 257..280 CDD:275380 5/26 (19%)
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
LRR_8 304..363 CDD:290566 20/58 (34%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
leucine-rich repeat 329..352 CDD:275380 7/22 (32%)
LRR_8 352..416 CDD:290566 19/80 (24%)
leucine-rich repeat 353..376 CDD:275380 8/22 (36%)
LRRCT 414..>450 CDD:214507 12/45 (27%)
Lrit3NP_001274153.1 LRR 1. /evidence=ECO:0000255 56..79 5/34 (15%)
LRR_8 61..117 CDD:290566 18/55 (33%)
LRR 2. /evidence=ECO:0000255 80..103 7/22 (32%)
leucine-rich repeat 83..106 CDD:275378 7/22 (32%)
LRR 3. /evidence=ECO:0000255 104..128 8/23 (35%)
LRR_8 105..165 CDD:290566 17/59 (29%)
LRR_4 106..146 CDD:289563 13/39 (33%)
leucine-rich repeat 107..130 CDD:275378 7/22 (32%)
LRR_4 129..170 CDD:289563 13/48 (27%)
LRR 4. /evidence=ECO:0000255 129..151 7/21 (33%)
leucine-rich repeat 131..154 CDD:275378 8/22 (36%)
LRR 5. /evidence=ECO:0000255 152..175 5/30 (17%)
leucine-rich repeat 155..168 CDD:275378 3/12 (25%)
Ig 254..335 CDD:299845 6/19 (32%)
IG_like 263..339 CDD:214653 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..391
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..464
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.