| Sequence 1: | NP_523930.3 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848829.2 | Gene: | Lrfn5 / 238205 | MGIID: | 2144814 | Length: | 746 | Species: | Mus musculus |
| Alignment Length: | 313 | Identity: | 86/313 - (27%) |
|---|---|---|---|
| Similarity: | 131/313 - (41%) | Gaps: | 64/313 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 232 RLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTS 296
Fly 297 EIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNN 361
Fly 362 LLKKIDNGLLRGTPALLSINVQANKLETL----TFYTFQPIMDNLVNSTSELLVS--DNKFICDC 420
Fly 421 RLQWIFELKNR--------------------------------TRHLQLRDSLEDLHCTLQ---- 449
Fly 450 ---EPKLSHFVDPVPPTI-------------LDVL-----NIGGFTAIGSNSA 481 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_523930.3 | LRR | <157..459 | CDD:443914 | 74/271 (27%) |
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | 86/313 (27%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 7/22 (32%) | ||
| Lrfn5 | NP_848829.2 | LRR 1 | 52..73 | 7/20 (35%) | |
| leucine-rich repeat | 53..76 | CDD:275380 | 7/22 (32%) | ||
| LRR | <55..>211 | CDD:443914 | 51/155 (33%) | ||
| LRR 2 | 76..97 | 6/20 (30%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 100..121 | 6/20 (30%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 8/22 (36%) | ||
| LRR 4 | 124..145 | 9/20 (45%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 8/22 (36%) | ||
| LRR 5 | 148..169 | 8/20 (40%) | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
| LRR 6 | 172..193 | 7/20 (35%) | |||
| leucine-rich repeat | 173..196 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 196..217 | 5/20 (25%) | |||
| leucine-rich repeat | 197..215 | CDD:275380 | 5/17 (29%) | ||
| LRRCT | 240..>272 | CDD:214507 | 6/31 (19%) | ||
| IgI_SALM5_like | 287..374 | CDD:409421 | 22/78 (28%) | ||
| Ig strand A | 287..290 | CDD:409421 | 0/2 (0%) | ||
| Ig strand A' | 294..297 | CDD:409421 | 0/2 (0%) | ||
| Ig strand B | 303..311 | CDD:409421 | 2/7 (29%) | ||
| Ig strand C | 317..322 | CDD:409421 | 1/5 (20%) | ||
| Ig strand C' | 325..327 | CDD:409421 | 0/1 (0%) | ||
| Ig strand D | 333..337 | CDD:409421 | 0/3 (0%) | ||
| Ig strand E | 340..344 | CDD:409421 | 1/3 (33%) | ||
| Ig strand F | 354..361 | CDD:409421 | 3/6 (50%) | ||
| Ig strand G | 364..374 | CDD:409421 | 86/313 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..416 | ||||
| FN3 | 421..494 | CDD:473895 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||