DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lrfn3

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_780687.1 Gene:Lrfn3 / 233067 MGIID:2442512 Length:626 Species:Mus musculus


Alignment Length:257 Identity:73/257 - (28%)
Similarity:107/257 - (41%) Gaps:40/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 RLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTS 296
            |..||.|..|.|..:.|....|:.....|.|:.|.|..:..|.|||:..|..|:|..|::..|..
Mouse    60 RAAELRLADNFIAAVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLTSLGE 124

  Fly   297 EIFRGLGNLNVLKLTRNNLNFIGDTVF---AELWSLSELELDDNRIERISERALDGLNTLKTLNL 358
            ...|||.||..|.|:.|.|..:.....   ||  :|.:|:|..|.:|::...||..|..:.||.|
Mouse   125 GQLRGLVNLRHLILSNNQLAALAAGALDDCAE--TLEDLDLSYNNLEQLPWEALGRLGNVNTLGL 187

  Fly   359 RNNLLKKIDNGLLRGTPALLSINVQANKLETL---TFYTFQPIMDNLVNSTSELLV---SDNKFI 417
            .:|||..:..|.......|..:::.:|:|.|:   ..::..|::.....|.:..||   ..|...
Mouse   188 DHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPASALVLAFGGNPLH 252

  Fly   418 CDCRLQWIFELKNRTRHLQLRDSLEDLHCTLQEPKLSHFVDPVPPTILDVLNIGG--FTAIG 477
            |:|.|.|:       |.|...|.||  .|.            .||.      :||  |.|:|
Mouse   253 CNCELVWL-------RRLAREDDLE--ACA------------SPPA------LGGRYFWAVG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 66/235 (28%)
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380 73/257 (28%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 8/22 (36%)
leucine-rich repeat 305..328 CDD:275380 7/25 (28%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
leucine-rich repeat 353..376 CDD:275380 7/22 (32%)
Lrfn3NP_780687.1 leucine-rich repeat 63..84 CDD:275380 7/20 (35%)
LRR <78..>228 CDD:443914 44/151 (29%)
LRR 1 84..105 6/20 (30%)
leucine-rich repeat 85..108 CDD:275380 8/22 (36%)
LRR 2 108..129 5/20 (25%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR 3 132..153 6/20 (30%)
leucine-rich repeat 133..157 CDD:275380 7/25 (28%)
LRR 4 157..178 7/20 (35%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
LRR 5 181..202 7/20 (35%)
leucine-rich repeat 182..205 CDD:275380 7/22 (32%)
LRR 6 205..226 4/20 (20%)
leucine-rich repeat 206..230 CDD:275380 4/23 (17%)
leucine-rich repeat 242..253 CDD:275378 3/10 (30%)
LRRCT 249..>281 CDD:214507 14/58 (24%)
Ig 296..383 CDD:472250
Ig strand B 313..317 CDD:409353
Ig strand C 326..330 CDD:409353
Ig strand E 349..353 CDD:409353
Ig strand F 363..368 CDD:409353
Ig strand G 376..379 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..425
fn3 425..502 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..626
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.