DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lrrc26

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_666229.1 Gene:Lrrc26 / 227618 MGIID:2385129 Length:331 Species:Mus musculus


Alignment Length:198 Identity:56/198 - (28%)
Similarity:84/198 - (42%) Gaps:41/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFA 324
            |.|::|.:|.|..|.||:...|.:|:|..|::..:.:..|.|||.|..|.|:.|.|..:....||
Mouse    76 LLLDHNRVSALPPGAFANAGALLYLDLRENRLRSVHARAFWGLGVLQWLDLSSNQLETLPPGTFA 140

  Fly   325 ELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLET 389
            .|.:||.|.|..||:..:....|..|..|:.|:|::|.|..|:.|||...|||            
Mouse   141 PLRALSFLSLAGNRLALLEPSILGPLPLLRVLSLQDNSLSAIEAGLLNNLPAL------------ 193

  Fly   390 LTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQ----WIFELKNRTRHLQLRDSLEDLHCTLQE 450
                             ..|.:..|.:.|:|.|:    |:      .:|.:.....|.|.|.  .
Mouse   194 -----------------DVLRLHGNPWTCNCALRPLCTWL------RKHPRPASETETLLCV--S 233

  Fly   451 PKL 453
            |:|
Mouse   234 PRL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 56/198 (28%)
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..256 CDD:275380
leucine-rich repeat 257..280 CDD:275380 8/19 (42%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
leucine-rich repeat 353..376 CDD:275380 9/22 (41%)
Lrrc26NP_666229.1 LRR <62..>201 CDD:443914 45/153 (29%)
LRR 1 72..93 7/16 (44%)
leucine-rich repeat 73..96 CDD:275380 8/19 (42%)
LRR 2 96..117 5/20 (25%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
LRR 3 120..141 6/20 (30%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
LRR 4 144..165 7/20 (35%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
LRR 5 168..191 9/22 (41%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
PCC 174..>267 CDD:188093 22/100 (22%)
leucine-rich repeat 236..255 CDD:275380 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..331
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.