DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lgi3

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_660254.1 Gene:Lgi3 / 213469 MGIID:2182619 Length:548 Species:Mus musculus


Alignment Length:281 Identity:60/281 - (21%)
Similarity:105/281 - (37%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGSTGYSGP------MDSTGFC-----TRRRDMKL-----MCYCTPDENHVPVQKAECWVFSEGL 142
            :|.....||      :.:.|||     :.:|..|.     .|.||                    
Mouse     2 AGLRARRGPGRRLLVLSTLGFCLMLQVSAKRPPKTPPCPPSCSCT-------------------- 46

  Fly   143 HQNDTTWTRFYQQKRLRELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEI----VKSYAF 203
                            |:..|.:.:.:    :|       |||.|.||..:.|..    ::..||
Mouse    47 ----------------RDTAFCVDSKS----VP-------KNLPSEVISLTLVNAAFSEIQDGAF 84

  Fly   204 ANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNIS 268
            ::||.|:.::||:|....:..:||.....|:.|.:|:|.|:.:.::.||.|.....|.|.|||:.
Mouse    85 SHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQ 149

  Fly   269 TLHEGLFADMARLTFLNLAHNQIN--VLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSE 331
            ||...:|..:..|:.|:|..|.:|  .....:...|.:.|              |..|.::..|.
Mouse   150 TLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTN--------------TTVAPIYCASP 200

  Fly   332 LELDDNRIERISERALDGLNT 352
            ....:::::.:..|..|.:.|
Mouse   201 PRFQEHKVQDLPLREFDCITT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 40/147 (27%)
LRR_8 183..243 CDD:290566 21/63 (33%)
leucine-rich repeat 185..208 CDD:275380 8/26 (31%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
LRR_RI <225..416 CDD:238064 31/130 (24%)
LRR_8 232..291 CDD:290566 20/58 (34%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 6/24 (25%)
LRR_8 304..363 CDD:290566 7/49 (14%)
leucine-rich repeat 305..328 CDD:275380 3/22 (14%)
leucine-rich repeat 329..352 CDD:275380 3/22 (14%)
LRR_8 352..416 CDD:290566 1/1 (100%)
leucine-rich repeat 353..376 CDD:275380 60/281 (21%)
LRRCT 414..>450 CDD:214507
Lgi3NP_660254.1 LRR_8 68..124 CDD:338972 15/55 (27%)
leucine-rich repeat 68..89 CDD:275378 4/20 (20%)
LRR 1 89..110 6/20 (30%)
leucine-rich repeat 90..113 CDD:275378 6/22 (27%)
LRR_8 113..172 CDD:338972 20/58 (34%)
LRR 2 113..134 6/20 (30%)
leucine-rich repeat 114..137 CDD:275378 8/22 (36%)
LRR 3 137..158 8/20 (40%)
leucine-rich repeat 138..161 CDD:275378 8/22 (36%)
PCC 143..>218 CDD:188093 18/88 (20%)
leucine-rich repeat 162..174 CDD:275378 4/11 (36%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 222..264 60/281 (21%)
EPTP 223..262 CDD:367630
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 268..310
EPTP 270..308 CDD:367630
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 314..361
EPTP 315..359 CDD:367630
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 363..406
EPTP 364..404 CDD:367630
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 410..453
EPTP <422..451 CDD:367630
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 455..497
EPTP 456..495 CDD:367630
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 501..543
EPTP 502..541 CDD:367630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.