Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001345621.1 | Gene: | Elfn2 / 207393 | MGIID: | 3608416 | Length: | 823 | Species: | Mus musculus |
Alignment Length: | 224 | Identity: | 61/224 - (27%) |
---|---|---|---|
Similarity: | 104/224 - (46%) | Gaps: | 33/224 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 RNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLN 316
Fly 317 FIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSIN 381
Fly 382 VQANKLETLTFYTFQPIMDNLVNSTSELLVSD---NKFICDCR----LQWIFELKNRTRH---LQ 436
Fly 437 LRDSLEDLHCTLQEPKLSHFVDPVPPTIL 465 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 10/38 (26%) |
LRR_8 | 183..243 | CDD:290566 | |||
leucine-rich repeat | 185..208 | CDD:275380 | |||
leucine-rich repeat | 209..232 | CDD:275380 | |||
LRR_RI | <225..416 | CDD:238064 | 46/166 (28%) | ||
LRR_8 | 232..291 | CDD:290566 | 10/38 (26%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 1/3 (33%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 304..363 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 352..416 | CDD:290566 | 17/66 (26%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 4/22 (18%) | ||
LRRCT | 414..>450 | CDD:214507 | 12/42 (29%) | ||
Elfn2 | NP_001345621.1 | LRR 1 | 56..77 | 5/31 (16%) | |
leucine-rich repeat | 60..80 | CDD:275378 | 3/19 (16%) | ||
LRR_8 | 80..139 | CDD:404697 | 21/58 (36%) | ||
LRR 2 | 80..101 | 9/20 (45%) | |||
leucine-rich repeat | 81..104 | CDD:275378 | 8/22 (36%) | ||
LRR 3 | 104..125 | 8/20 (40%) | |||
leucine-rich repeat | 105..128 | CDD:275378 | 8/22 (36%) | ||
LRR_8 | 127..187 | CDD:404697 | 17/67 (25%) | ||
LRR 4 | 128..149 | 4/20 (20%) | |||
leucine-rich repeat | 129..152 | CDD:275378 | 4/22 (18%) | ||
LRR 5 | 152..173 | 8/28 (29%) | |||
leucine-rich repeat | 153..166 | CDD:275378 | 5/12 (42%) | ||
PCC | 157..>227 | CDD:188093 | 19/77 (25%) | ||
leucine-rich repeat | 177..189 | CDD:275378 | 4/11 (36%) | ||
leucine-rich repeat | 200..226 | CDD:275380 | 5/25 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 249..294 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 590..624 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167831260 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |