DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and LGI3

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_644807.1 Gene:LGI3 / 203190 HGNCID:18711 Length:548 Species:Homo sapiens


Alignment Length:285 Identity:63/285 - (22%)
Similarity:107/285 - (37%) Gaps:101/285 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GYSGP----MDSTGFC-----TRRRDMKL-----MCYCTPDENHVPVQKAECWVFSEGLHQNDTT 148
            |..||    :.:.|||     :.:|..|.     .|.||                          
Human     8 GGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCT-------------------------- 46

  Fly   149 WTRFYQQKRLRELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEI----VKSYAFANLPFL 209
                      |:..|.:.:.|    :|       :||.|.||..:.|..    ::..||::||.|
Human    47 ----------RDTAFCVDSKA----VP-------RNLPSEVISLTLVNAAFSEIQDGAFSHLPLL 90

  Fly   210 ERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGL 274
            :.::||:|....:..:||.....|:.|.:|:|.|:.:.::.||.|                    
Human    91 QFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTFRGL-------------------- 135

  Fly   275 FADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLN----------FIG--DTVFAELW 327
                ..||.|:||:|.:..|..:|||.|..||.|.|..|:||          ::.  :|..|.::
Human   136 ----KSLTHLSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIY 196

  Fly   328 SLSELELDDNRIERISERALDGLNT 352
            ..|.....:::::.:..|..|.:.|
Human   197 CASPPRFQEHKVQDLPLREFDCITT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 34/147 (23%)
LRR_8 183..243 CDD:290566 20/63 (32%)
leucine-rich repeat 185..208 CDD:275380 8/26 (31%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
LRR_RI <225..416 CDD:238064 34/140 (24%)
LRR_8 232..291 CDD:290566 14/58 (24%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 0/22 (0%)
leucine-rich repeat 281..304 CDD:275380 11/22 (50%)
LRR_8 304..363 CDD:290566 13/61 (21%)
leucine-rich repeat 305..328 CDD:275380 9/34 (26%)
leucine-rich repeat 329..352 CDD:275380 3/22 (14%)
LRR_8 352..416 CDD:290566 1/1 (100%)
leucine-rich repeat 353..376 CDD:275380 63/285 (22%)
LRRCT 414..>450 CDD:214507
LGI3NP_644807.1 LRR_8 68..124 CDD:290566 15/55 (27%)
leucine-rich repeat 68..89 CDD:275378 4/20 (20%)
LRR 1 89..110 6/20 (30%)
leucine-rich repeat 90..113 CDD:275378 6/22 (27%)
LRR_8 112..172 CDD:290566 24/83 (29%)
LRR_4 113..152 CDD:289563 14/62 (23%)
LRR 2 113..134 6/20 (30%)
leucine-rich repeat 114..137 CDD:275378 8/46 (17%)
LRR 135..158 CDD:197688 10/46 (22%)
LRR 3 137..158 9/20 (45%)
leucine-rich repeat 138..161 CDD:275378 11/22 (50%)
leucine-rich repeat 162..174 CDD:275378 6/11 (55%)
LRRCT 170..218 CDD:214507 7/47 (15%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 222..264 63/285 (22%)
EPTP 222..263 CDD:281697 63/285 (22%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 268..310
EPTP 268..309 CDD:281697
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 314..361
EPTP 314..359 CDD:281697
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 363..406
EPTP 363..405 CDD:281697
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 410..453
EPTP 410..452 CDD:281697
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 455..497
EPTP 455..496 CDD:281697
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 501..543
EPTP 501..541 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.