DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and dma-1

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:313 Identity:79/313 - (25%)
Similarity:136/313 - (43%) Gaps:49/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QNDTTWTRFYQQKRLRELKFV-IQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLP 207
            |||::|:.:.::..:.:..:. |.|...|......|..|...:.|..:.::.    ....||.|.
 Worm    32 QNDSSWSVYCRKAIINDTIYAEILNQLPLTLRSLHIQPPSNRIGSNKLRWND----NINRFAQLR 92

  Fly   208 FLERIILNNNHIMALDQDAFANHIR---LRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNIST 269
            .|..|   |..|.|:.:.     ||   |..|:|..|.|.......|..:|....|.|::|:::.
 Worm    93 VLRLI---NCQIPAMSRS-----IRLPSLEVLDLHSNNIEHATMSNFGGMPKLRVLDLSSNHLNI 149

  Fly   270 LHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRN-----NLNFIGDTVFAELWSL 329
            |..|:|..:..|..|:|::|.|:.|::.:.|||.:|.||:|.||     ::|    .:|.::..|
 Worm   150 LPTGVFTYLRALRSLSLSNNTISDLSTNLLRGLNSLRVLRLDRNPIPIEHIN----ELFTDVSQL 210

  Fly   330 SELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYT 394
            .||.|:...:..|...|||.:..|:.|.:..|.||.:....||..|.|..:::..|.::.:|...
 Worm   211 DELYLNHCNLSSIYSLALDRIPQLRQLGIGGNNLKMVPTKELRSLPQLSVLDLSHNSIQEITACA 275

  Fly   395 F-------QPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRT---RHLQL 437
            |       ..:..||:..:.:...:::.|              ||   |||.|
 Worm   276 FCNTNISKLDLSHNLLGISKDSPFNEDAF--------------RTMPLRHLDL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 34/147 (23%)
LRR_8 183..243 CDD:290566 15/62 (24%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
LRR_RI <225..416 CDD:238064 54/205 (26%)
LRR_8 232..291 CDD:290566 18/61 (30%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
LRR_8 304..363 CDD:290566 19/63 (30%)
leucine-rich repeat 305..328 CDD:275380 8/27 (30%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
LRR_8 352..416 CDD:290566 14/70 (20%)
leucine-rich repeat 353..376 CDD:275380 7/22 (32%)
LRRCT 414..>450 CDD:214507 7/27 (26%)
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 18/64 (28%)
leucine-rich repeat 91..112 CDD:275380 8/28 (29%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR 136..430 CDD:227223 52/197 (26%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 8/27 (30%)
leucine-rich repeat 210..233 CDD:275380 8/22 (36%)
leucine-rich repeat 234..257 CDD:275380 7/22 (32%)
leucine-rich repeat 258..280 CDD:275380 4/21 (19%)
leucine-rich repeat 281..307 CDD:275380 4/39 (10%)
leucine-rich repeat 309..357 CDD:275380 4/6 (67%)
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
TPKR_C2 438..>478 CDD:387596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.