| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499896.1 | Gene: | sma-10 / 176849 | WormBaseID: | WBGene00020649 | Length: | 881 | Species: | Caenorhabditis elegans |
| Alignment Length: | 315 | Identity: | 74/315 - (23%) |
|---|---|---|---|
| Similarity: | 130/315 - (41%) | Gaps: | 62/315 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 171 LDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRE 235
Fly 236 LNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFR 300
Fly 301 GLGNLNVLKLT------------------------RNNLNFIGDTVFAELWSLSELELDDNRIER 341
Fly 342 ISERALDGLNTLKTLNLRNNLLKKI--DNGLLRGT--------------------------PALL 378
Fly 379 SINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRL----QWIFELK 429 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 32/119 (27%) |
| LRR_8 | 183..243 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <225..416 | CDD:238064 | 56/242 (23%) | ||
| LRR_8 | 232..291 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 304..363 | CDD:290566 | 20/82 (24%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/46 (15%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 352..416 | CDD:290566 | 16/91 (18%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 8/50 (16%) | ||
| LRRCT | 414..>450 | CDD:214507 | 7/20 (35%) | ||
| sma-10 | NP_499896.1 | LRRNT | 29..54 | CDD:214470 | |
| leucine-rich repeat | 55..77 | CDD:275380 | |||
| LRR_8 | 78..135 | CDD:290566 | |||
| LRR_4 | 78..116 | CDD:289563 | |||
| leucine-rich repeat | 78..101 | CDD:275380 | |||
| LRR_RI | 100..303 | CDD:238064 | 39/143 (27%) | ||
| leucine-rich repeat | 102..124 | CDD:275380 | |||
| leucine-rich repeat | 125..148 | CDD:275380 | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 2/12 (17%) | ||
| LRR_8 | 172..231 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 243..303 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | 269..453 | CDD:238064 | 40/189 (21%) | ||
| leucine-rich repeat | 269..292 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 293..316 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 315..373 | CDD:290566 | 15/57 (26%) | ||
| leucine-rich repeat | 317..340 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 341..364 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 365..392 | CDD:275380 | 8/26 (31%) | ||
| LRR_8 | 393..450 | CDD:290566 | 8/62 (13%) | ||
| leucine-rich repeat | 393..416 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 417..438 | CDD:275380 | 4/20 (20%) | ||
| I-set | 506..612 | CDD:254352 | |||
| Ig | 522..606 | CDD:143165 | |||
| I-set | 616..705 | CDD:254352 | |||
| Ig | 633..705 | CDD:299845 | |||
| Ig | 716..786 | CDD:299845 | |||
| IG | 719..788 | CDD:214652 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||