DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and CHADL

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_054181131.1 Gene:CHADL / 150356 HGNCID:25165 Length:771 Species:Homo sapiens


Alignment Length:576 Identity:138/576 - (23%)
Similarity:201/576 - (34%) Gaps:154/576 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CYCTPDENHVPVQKAECWVFSEGLHQNDTTWTRFYQQKRLREL--KFVIQNNARLDYIPTMIIEP 181
            |.|.....||..:           :||.|.     ....:.||  :..:|.|. |..||....:.
Human    37 CICDNSRRHVACR-----------YQNLTE-----VPDAIPELTQRLDLQGNL-LKVIPAAAFQG 84

  Fly   182 LKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEM 246
            :.:|:.:.:.:.:||:|...||..|..|..:.|.:||:..|.|:|......||.|.||.|.:.|:
Human    85 VPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALDGLGSLRRLELEGNALEEL 149

  Fly   247 DRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLT 311
            ....|..|.....|.|.:|.:..|....|..:.|:.:|.|:||.::||..|...||..|..|.|.
Human   150 RPGTFGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSVLAPEALAGLPALRRLSLH 214

  Fly   312 RNNLNFIGDTVFAELWSLSELELDDNRIERISER---ALDGLNTLKTLNLRNNLLKKIDNGLLRG 373
            .|.|..:...|.::...|:.|||..|.:....|.   ||.||..|           .:|.|.|:.
Human   215 HNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLREL-----------LLDGGALQA 268

  Fly   374 --------TPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCR----LQWIF 426
                    .|.|.:::::.|:|:||     .|:..  ......|.:..|...|.|:    |:|:.
Human   269 LGPRAFAHCPRLHTLDLRGNQLDTL-----PPLQG--PGQLRRLRLQGNPLWCGCQARPLLEWLA 326

  Fly   427 ELKNRT-------RHL--QLRDSLE--DLHC---------TLQE----------------PKLSH 455
            ..:.|:       |.|  :..|:|.  ||.|         .|:|                |....
Human   327 RARVRSDGACQGPRRLRGEALDALRPWDLRCPGDAAQEEEELEERAVAGPRAPPRGPPRGPGEER 391

  Fly   456 FVDPVPPTILDVLNIGGFTAIGSNSASMGGVGNSVVGSSYSGLT--MDDSRKHLGSRSRQALRGQ 518
            .|.|.|...:.|..        |..:|..|.|...|...:...|  :|..|.|..|..|.|..|.
Human   392 AVAPCPRACVCVPE--------SRHSSCEGCGLQAVPRGFPSDTQLLDLRRNHFPSVPRAAFPGL 448

  Fly   519 RQFASSAENVVESKMRRRRKRQEEVKEKDLAAVAPAHKR-YDYYDDN----------NGGMSLGH 572
            ....|            ...:...:.|.:..|:|...:. |.|..||          .|...||:
Human   449 GHLVS------------LHLQHCGIAELEAGALAGLGRLIYLYLSDNQLAGLSAAALEGAPRLGY 501

  Fly   573 GLDLDDN----------------LSLHKQGFYGAGSPVVGHNDVDVLMTSHSASGD 612
             |.|:.|                .|||.|           .|.||.|     |.||
Human   502 -LYLERNRFLQVPGAALRALPSLFSLHLQ-----------DNAVDRL-----APGD 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 90/354 (25%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 10/25 (40%)
leucine-rich repeat 353..376 CDD:275380 4/30 (13%)
CHADLXP_054181131.1 LRRNT 33..65 CDD:214470 9/43 (21%)
leucine-rich repeat 44..62 CDD:275380 5/33 (15%)
leucine-rich repeat 64..87 CDD:275380 5/23 (22%)
LRR_8 65..146 CDD:404697 25/81 (31%)
leucine-rich repeat 88..135 CDD:275380 14/46 (30%)
LRR <128..>312 CDD:443914 54/201 (27%)
leucine-rich repeat 136..159 CDD:275380 9/22 (41%)
leucine-rich repeat 160..183 CDD:275380 5/22 (23%)
leucine-rich repeat 184..207 CDD:275380 9/22 (41%)
leucine-rich repeat 208..231 CDD:275380 6/22 (27%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
leucine-rich repeat 256..279 CDD:275380 5/33 (15%)
LRRNT 395..429 CDD:214470 9/41 (22%)
leucine-rich repeat 410..426 CDD:275380 4/15 (27%)
leucine-rich repeat 427..450 CDD:275380 8/22 (36%)
LRR <445..>677 CDD:443914 26/125 (21%)
leucine-rich repeat 451..474 CDD:275380 4/34 (12%)
leucine-rich repeat 475..498 CDD:275380 5/22 (23%)
leucine-rich repeat 499..522 CDD:275380 5/23 (22%)
leucine-rich repeat 523..546 CDD:275380 11/34 (32%)
leucine-rich repeat 547..570 CDD:275380
leucine-rich repeat 571..594 CDD:275380
leucine-rich repeat 595..619 CDD:275380
leucine-rich repeat 620..644 CDD:275380
LRRCT 675..723 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.