DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and LRG1

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_443204.1 Gene:LRG1 / 116844 HGNCID:29480 Length:347 Species:Homo sapiens


Alignment Length:265 Identity:66/265 - (24%)
Similarity:105/265 - (39%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 LDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRE 235
            |.::|..:::....|..:.:..:.:|.:.......:|.|..:.|..|.:..|....|.....|..
Human    80 LTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDT 144

  Fly   236 LNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFR 300
            |.|:.||:..::......|.....|.|:.|.:..|..||.|:...|..|:|..||:..|..::.|
Human   145 LVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLR 209

  Fly   301 GLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKK 365
            |...|..|.|..|.|..:|..:......|..|.|:.|::.|::..|..||..|..|:|.||.|..
Human   210 GPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLAS 274

  Fly   366 IDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRL----QWIF 426
            :..||.    |.|.                ||..|    ......:|.|.:|||..|    :|:.
Human   275 VPEGLW----ASLG----------------QPNWD----MRDGFDISGNPWICDQNLSDLYRWLQ 315

  Fly   427 ELKNR 431
            ..|::
Human   316 AQKDK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 66/265 (25%)
leucine-rich repeat 185..208 CDD:275380 2/22 (9%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 8/22 (36%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
leucine-rich repeat 353..376 CDD:275380 8/22 (36%)
LRG1NP_443204.1 LRR <79..319 CDD:443914 65/262 (25%)
LRR 1 93..114 2/20 (10%)
leucine-rich repeat 94..117 CDD:275380 2/22 (9%)
LRR 2 117..138 5/20 (25%)
leucine-rich repeat 118..141 CDD:275380 5/22 (23%)
LRR 3 141..162 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
LRR 4 165..186 6/20 (30%)
leucine-rich repeat 166..189 CDD:275380 7/22 (32%)
LRR 5 189..210 6/20 (30%)
leucine-rich repeat 190..213 CDD:275380 8/22 (36%)
LRR 6 213..234 6/20 (30%)
leucine-rich repeat 214..237 CDD:275380 6/22 (27%)
LRR 7 237..258 6/20 (30%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
LRR 8 261..282 8/24 (33%)
leucine-rich repeat 262..285 CDD:275380 10/42 (24%)
LRRCT 299..346 CDD:214507 7/22 (32%)

Return to query results.
Submit another query.