Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_821072.1 | Gene: | Lrrtm2 / 107065 | MGIID: | 2389174 | Length: | 515 | Species: | Mus musculus |
Alignment Length: | 331 | Identity: | 93/331 - (28%) |
---|---|---|---|
Similarity: | 141/331 - (42%) | Gaps: | 66/331 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 LNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADM 278
Fly 279 ARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERIS 343
Fly 344 ERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLT----------------- 391
Fly 392 ----------FYTFQP----IMDN---------LVNSTSELL---VSDNKFICDCRL----QWIF 426
Fly 427 ELKNRTR---------HLQLRDSLEDLH----CTLQEPKLSHFVDPVPPTILDVLNIGGFTAIGS 478
Fly 479 NSASMG 484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 29/76 (38%) |
LRR_8 | 183..243 | CDD:290566 | 14/28 (50%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | |||
leucine-rich repeat | 209..232 | CDD:275380 | 9/17 (53%) | ||
LRR_RI | <225..416 | CDD:238064 | 67/233 (29%) | ||
LRR_8 | 232..291 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 304..363 | CDD:290566 | 19/58 (33%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 352..416 | CDD:290566 | 23/106 (22%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 414..>450 | CDD:214507 | 11/52 (21%) | ||
Lrrtm2 | NP_821072.1 | LRR 1 | 63..83 | 8/14 (57%) | |
LRR | <65..312 | CDD:227223 | 72/243 (30%) | ||
leucine-rich repeat | 66..86 | CDD:275380 | 9/17 (53%) | ||
LRR 2 | 86..107 | 9/20 (45%) | |||
leucine-rich repeat | 87..110 | CDD:275380 | 10/22 (45%) | ||
LRR 3 | 110..131 | 6/20 (30%) | |||
leucine-rich repeat | 111..134 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 134..155 | 8/20 (40%) | |||
leucine-rich repeat | 135..158 | CDD:275380 | 10/22 (45%) | ||
LRR 5 | 158..179 | 7/20 (35%) | |||
leucine-rich repeat | 159..182 | CDD:275380 | 7/22 (32%) | ||
LRR 6 | 182..203 | 6/20 (30%) | |||
leucine-rich repeat | 183..206 | CDD:275380 | 7/22 (32%) | ||
LRR 7 | 206..227 | 7/20 (35%) | |||
leucine-rich repeat | 207..230 | CDD:275380 | 7/22 (32%) | ||
LRR 8 | 230..251 | 6/20 (30%) | |||
leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
LRR 9 | 254..275 | 1/20 (5%) | |||
leucine-rich repeat | 255..278 | CDD:275380 | 2/22 (9%) | ||
LRR 10 | 278..299 | 3/20 (15%) | |||
leucine-rich repeat | 279..300 | CDD:275380 | 4/20 (20%) | ||
PCC | 284..>351 | CDD:188093 | 15/66 (23%) | ||
Involved in DLG4-binding. /evidence=ECO:0000250 | 512..515 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167831220 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |