DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Chadl

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_038936217.1 Gene:Chadl / 100910434 RGDID:6504353 Length:747 Species:Rattus norvegicus


Alignment Length:709 Identity:151/709 - (21%)
Similarity:235/709 - (33%) Gaps:224/709 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CYCTPDENHVPVQKAECWVFSEGLHQNDTTWTRFYQQKRLRELKFVIQNNARLDYIPTMIIEPLK 183
            |.|.....||..|           |||                         |..:|..|.|..:
  Rat    41 CVCDNSRRHVTCQ-----------HQN-------------------------LTEVPDTIPELTQ 69

  Fly   184 NLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDR 248
            .|.   ::.:.::::...||.:||:|..:.|.:..:..:.:.||....||..|||..|::..:.:
  Rat    70 RLD---LQGNMLKVIPPAAFQDLPYLTHLDLQHCQVEQVAEGAFRGLGRLLFLNLASNRLSSLPQ 131

  Fly   249 YAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRN 313
            .|...|....||.|..|.:..|..|.|..:..|..||||||.:..|.:..|:||.....|:|:.|
  Rat   132 EALDGLGSLRRLELERNMLEELRPGTFGALGSLATLNLAHNALVYLPAMAFQGLMRTRWLQLSHN 196

  Fly   314 NLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLK-------------- 364
            .|:.:.....|.|..|..|.|..|.::.:...||....:|..|.|.:|.|.              
  Rat   197 ALSVLAPEALAGLPVLRRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLR 261

  Fly   365 --KIDNGLLRG--------TPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICD 419
              .:|:|.|:.        .|.|.:::::.|:|.||     .|:  .:......|.:..|...|.
  Rat   262 ELALDHGSLQALGPRAFAHCPRLHTLDLRGNQLTTL-----PPL--QVPGQLRRLRLQGNPLWCA 319

  Fly   420 CR----LQWIFELKNRT-------RHLQ------LRDSLEDLHC---------------TLQEPK 452
            |.    |:|:...:.|:       |.|:      ||.|  ||.|               ....|:
  Rat   320 CHARPLLEWLVRARVRSDGACRGPRRLRGETLDTLRPS--DLRCPGDAAEDEDEDRPAGPRSPPR 382

  Fly   453 LSH----FVDPVPPTILDVLNIGGFTAIG-SNSASMGGVGNSVVGSSYSGLT--MDDSRKHLGSR 510
            ..|    :..|.||..:         .:| :..::..|.|...|...:...|  :|..|.|..|.
  Rat   383 SLHEEARWATPCPPACV---------CVGETRHSACDGRGLQAVPRGFPNDTQLLDLRRNHFPSV 438

  Fly   511 SRQALRGQRQFASSAENVVESKMRRRRKRQEEVKEKDLAAVAPAHKRYDYYDDNN---------- 565
            .|.|..|.|...|            ...:...:.|.:..|:|........|..||          
  Rat   439 PRAAFPGLRHLVS------------LHLQHCGIAELEPGALAGLDGLVYLYLSNNQLSGLSAAAL 491

  Fly   566 -GGMSLGHGLDLDDN----------------LSLHKQ-------------------GFYGAGSPV 594
             |..:||: |.|:.|                .|||.|                   |.|.:|:  
  Rat   492 EGAPNLGY-LYLEHNRFLRIPGAALRALPRLFSLHLQDNAVDRLAPGDLAGARALRGLYLSGN-- 553

  Fly   595 VGHNDVDVLMTSHSASGDALDILTTKNAIYIKLFLLKPEM----------LPCHDELS------- 642
                  .:...|..|.|.|.::        .||.|.:.::          ||...||.       
  Rat   554 ------HITQVSPGALGPAREL--------EKLHLDRNQLRQVPTGALEGLPALKELQLSRNPFR 604

  Fly   643 ---DPTELPLSRDLMDVRSNVG--QDMSTAGANSLAQGM-------TIIVSLVALMMIS 689
               |....|:.|.|..:..|..  :.:|....:.|.:|:       ..:.||.|.|.:|
  Rat   605 ALHDGAFQPVGRSLQQLFLNSSDLEQISPRAFSGLGKGLQGLYLQQNQLQSLPAPMWLS 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 35/143 (24%)
LRR_8 183..243 CDD:290566 15/59 (25%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 4/22 (18%)
LRR_RI <225..416 CDD:238064 57/214 (27%)
LRR_8 232..291 CDD:290566 22/58 (38%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 11/22 (50%)
LRR_8 304..363 CDD:290566 16/58 (28%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 6/22 (27%)
LRR_8 352..416 CDD:290566 17/87 (20%)
leucine-rich repeat 353..376 CDD:275380 8/46 (17%)
LRRCT 414..>450 CDD:214507 14/67 (21%)
ChadlXP_038936217.1 PLN00113 30..>555 CDD:215061 127/591 (21%)
leucine-rich repeat 48..66 CDD:275380 9/53 (17%)
leucine-rich repeat 68..91 CDD:275380 4/25 (16%)
leucine-rich repeat 92..115 CDD:275380 4/22 (18%)
leucine-rich repeat 116..139 CDD:275380 7/22 (32%)
leucine-rich repeat 140..163 CDD:275380 7/22 (32%)
leucine-rich repeat 164..187 CDD:275380 11/22 (50%)
leucine-rich repeat 188..211 CDD:275380 6/22 (27%)
leucine-rich repeat 212..235 CDD:275380 6/22 (27%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
leucine-rich repeat 260..283 CDD:275380 3/22 (14%)
leucine-rich repeat 306..345 CDD:275380 7/38 (18%)
leucine-rich repeat 425..448 CDD:275380 8/22 (36%)
PPP1R42 446..603 CDD:411060 32/185 (17%)
leucine-rich repeat 449..472 CDD:275380 4/34 (12%)
leucine-rich repeat 473..496 CDD:275380 4/22 (18%)
leucine-rich repeat 497..520 CDD:275380 5/23 (22%)
leucine-rich repeat 521..544 CDD:275380 4/22 (18%)
leucine-rich repeat 545..568 CDD:275380 7/30 (23%)
leucine-rich repeat 569..592 CDD:275380 4/30 (13%)
LRR_8 591..653 CDD:404697 11/61 (18%)
leucine-rich repeat 593..617 CDD:275380 4/23 (17%)
leucine-rich repeat 618..641 CDD:275380 4/22 (18%)
leucine-rich repeat 643..665 CDD:275380 5/21 (24%)
leucine-rich repeat 666..677 CDD:275378
LRRCT 673..721 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.