| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 195 | Identity: | 51/195 - (26%) |
|---|---|---|---|
| Similarity: | 79/195 - (40%) | Gaps: | 34/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 262 LNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAEL 326
Fly 327 WSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETL- 390
Fly 391 ----TFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRDSLEDLHCTLQEP 451
Fly 452 451 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 9/28 (32%) |
| LRR_8 | 183..243 | CDD:290566 | |||
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | |||
| LRR_RI | <225..416 | CDD:238064 | 40/158 (25%) | ||
| LRR_8 | 232..291 | CDD:290566 | 9/28 (32%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | |||
| leucine-rich repeat | 257..280 | CDD:275380 | 5/17 (29%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 304..363 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 352..416 | CDD:290566 | 18/68 (26%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 414..>450 | CDD:214507 | 10/35 (29%) | ||
| lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
| leucine-rich repeat | 69..89 | CDD:275380 | |||
| LRR_8 | 112..172 | CDD:290566 | 23/83 (28%) | ||
| leucine-rich repeat | 114..137 | CDD:275378 | 9/46 (20%) | ||
| leucine-rich repeat | 138..161 | CDD:275378 | 7/22 (32%) | ||
| LRR_8 | 160..214 | CDD:290566 | 14/55 (25%) | ||
| LRR_4 | 160..201 | CDD:289563 | 13/40 (33%) | ||
| leucine-rich repeat | 162..185 | CDD:275378 | 9/22 (41%) | ||
| leucine-rich repeat | 186..199 | CDD:275378 | 2/12 (17%) | ||
| leucine-rich repeat | 215..230 | CDD:275378 | 3/14 (21%) | ||
| Ig | 278..391 | CDD:299845 | |||
| I-set | 279..391 | CDD:254352 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170574220 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||