DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh50 and AMT2

DIOPT Version :9

Sequence 1:NP_001369039.1 Gene:Rh50 / 38589 FlyBaseID:FBgn0028699 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_181363.1 Gene:AMT2 / 818409 AraportID:AT2G38290 Length:475 Species:Arabidopsis thaliana


Alignment Length:410 Identity:81/410 - (19%)
Similarity:145/410 - (35%) Gaps:119/410 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RKYGYSATGFTLF-MAALVVQWAVLM---------------------KGFLHMEGGKISLSLENI 119
            :|:..::....|: .||:::.|.:|.                     :|:|.   |:..:...|:
plant    49 KKWAVNSAFMALYAFAAVLLCWVLLCYKMAFGEELLPFWGKGGPAFDQGYLK---GQAKIPNSNV 110

  Fly   120 ------------IDADIAAAVPLISMGALLGRT--------TPIQLLCMSVFEVALFAANEYLA- 163
                        .....||...::..|::|||.        .|:.|    :|...:.|.:.:.. 
plant   111 AAPYFPMATLVYFQFTFAAITTILVAGSVLGRMNIKAWMAFVPLWL----IFSYTVGAYSIWGGG 171

  Fly   164 -LHVFSICDCGGSITVHAFGAYFGLAVALML--RPASDQNETGKLEGASYTSDIFAMIGTTFLWV 225
             |:.:.:.|..|...:|......|...|..:  ||.:|:      |.....:.:..:.|...||:
plant   172 FLYQWGVIDYSGGYVIHLSSGVAGFVAAYWVGPRPKADR------ERFPPNNVLLMLAGAGLLWM 230

  Fly   226 YWPSFN--SVLADGAGGERAILNTFLSLAAATV--TTFVVSALVSHENKLDMVHVQNSTLAGGVA 286
            .|..||  :..|.......|:|||.||.|.:.:  ||            ||::.....::.|.:.
plant   231 GWSGFNGGAPYAANLTSSIAVLNTNLSAATSLLVWTT------------LDVIFFGKPSVIGAIQ 283

  Fly   287 VGTVCNL--------LLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANL---------RLHDTCGV 334
             |.|..|        |:....|::||:::||         .||.:..:         ::.||..|
plant   284 -GMVTGLAGVTPGAGLIQTWAAIIIGVVSGT---------APWASMMIIHKKSALLQKVDDTLAV 338

  Fly   335 HNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLF 399
            ...|.:..|:..|.:.::|.           .|:...::....|.....||   |...|...||.
plant   339 FYTHAVAGLLGGIMTGLFAH-----------PDLCVLVLPLPATRGAFYGG---NGGKQLLKQLA 389

  Fly   400 GIAVTLLIAIGGGILTGAVL 419
            |.|   .||:...:.|..:|
plant   390 GAA---FIAVWNVVSTTIIL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh50NP_001369039.1 Ammonium_transp 55..422 CDD:413553 81/410 (20%)
AMT2NP_181363.1 AmtB 16..435 CDD:223083 81/410 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.