DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh50 and RHCE

DIOPT Version :9

Sequence 1:NP_001369039.1 Gene:Rh50 / 38589 FlyBaseID:FBgn0028699 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_011540191.2 Gene:RHCE / 6006 HGNCID:10008 Length:452 Species:Homo sapiens


Alignment Length:432 Identity:126/432 - (29%)
Similarity:204/432 - (47%) Gaps:80/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DAGSANEHVSKY---PQF--------QDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQW 97
            |||.|..|.| |   ..|        ||:.||..:|.|||.:..|::.:|:..|.|||.||.|||
Human    62 DAGPATLHAS-YSLSADFMPGTVLVGQDLTVMAALGLGFLTSNFRRHSWSSVAFNLFMLALGVQW 125

  Fly    98 AVLMKGFL-HMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVA------- 154
            |:|:.||| ....||:.::|.:|..|.::|...|||.||:||:....||:.|.:.||.       
Human   126 AILLDGFLSQFPPGKVVITLFSIRLATMSAMSVLISAGAVLGKVNLAQLVVMVLVEVTALGTLRM 190

  Fly   155 ----LFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALML-----RPASDQNETGKLEGASY 210
                :|..:.::.|..|           :.|.|||||.||..|     :...|.::...:...| 
Human   191 VISNIFNTDYHMNLRHF-----------YVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLS- 243

  Fly   211 TSDIFAMIGTTFLWVYWPSFNS-VLADGAGGERAILNTFLSLAAATVTTFVVSALVSHENKLDMV 274
                 ||:|..|||::|||.|| :|......:.|:.||:.:||.:.||....|:|...:.|:.|.
Human   244 -----AMLGALFLWMFWPSVNSALLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMT 303

  Fly   275 HVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHG 339
            :|.::.|||||||||.|:|:.....|:::|::||.:|:.|.:.|.......|.:|....:|::..
Human   304 YVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPVCCNRVLGIHHISVMHSIFS 368

  Fly   340 MPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLF----G 400
            :..|:..|...:...:.||.                             |.....|:|:.    .
Human   369 LLGLLGEITYIVLLVLHTVW-----------------------------NGNGMIGFQVLLSIGE 404

  Fly   401 IAVTLLIAIGGGILTGAVLKYTNFRNLKKDEHHQDEHYWEVP 442
            :::.::||:..|:|||.:|....::.....::..|:.:|:.|
Human   405 LSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh50NP_001369039.1 Ammonium_transp 55..422 CDD:413553 117/399 (29%)
RHCEXP_011540191.2 Ammonium_transp 62..412 CDD:322161 116/396 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311058at33208
OrthoFinder 1 1.000 - - FOG0000589
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11730
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.