DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13705 and CG13033

DIOPT Version :10

Sequence 1:NP_647938.1 Gene:CG13705 / 38587 FlyBaseID:FBgn0035582 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:107/257 - (41%) Gaps:89/257 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RRVIRRRRDVSELSPEYLPPVEESASEAVAVDTPLADDGYRYKTVRRVIRRRRDVNELPSGEYLP 259
            |.|:  |||||.|..|||||||                                :..:||.:|||
  Fly    20 RSVV--RRDVSHLPLEYLPPVE--------------------------------LPPVPSRDYLP 50

  Fly   260 PVEESASEAVAVETPLAADGYRYKTVRRVIRRRRD-VNELSAEYLPPV--EESASEA-------V 314
            |||:.|:                 |:..|::..|| :..|:.||||||  ||...|.       :
  Fly    51 PVEQHAA-----------------TLNHVLQPPRDYLPPLNNEYLPPVVEEEQKQEVPTTTEVII 98

  Fly   315 AVETPLADDGYRYKTVRRVI--RRRRDVSELSPEYLPPVEESASEAVAVETP--------LADDG 369
            ..||..|:     .|...||  ..:...:|:..|   |.||...:.|..|.|        |.|||
  Fly    99 PEETTTAE-----PTTEAVIITTEQPQEAEIITE---PQEEVEVKTVEEEEPEKEVESAVLLDDG 155

  Fly   370 YRYKTVRRVIRRRRDVSELPSGEYLPPVEETASAIIDVP---AEQTVLASDGYRYKTVRRLK 428
            |.|:|...|      .:.||..|||||::..| .:.::|   .:.:.|..|||.|::|:||:
  Fly   156 YHYRTPSVV------PNLLPVKEYLPPLDGNA-VVEELPNGEEDSSALLDDGYHYRSVKRLR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13705NP_647938.1 GYR 49..66 CDD:426962
GYR 417..432 CDD:426962 7/12 (58%)
CG13033NP_648902.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.