DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13705 and CG32237

DIOPT Version :9

Sequence 1:NP_647938.1 Gene:CG13705 / 38587 FlyBaseID:FBgn0035582 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster


Alignment Length:529 Identity:258/529 - (48%)
Similarity:329/529 - (62%) Gaps:108/529 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFVIAFAVIAAASAA--------------SIATDYLPPVDNNLESASELVEVPAEQGVLSDDG 51
            ||.| :|...||||:||              .|..:|:||.:   |..:||.:.||   .|.|||
  Fly     1 MKLF-LACIFIAAATAAVIPVEQARHRRDVSEIVNEYIPPAE---EVGAELAQDPA---ALGDDG 58

  Fly    52 YRYKTVRRLKLRHRRDVNELPSGEYLPPVEESASEAVAVETP----------LADDGYRYKTVRR 106
            ||||||||||||.||||:|: :.|||||.||..::|...|.|          ||.|||:||||||
  Fly    59 YRYKTVRRLKLRQRRDVSEI-ANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYKTVRR 122

  Fly   107 V-IRRRRDVSELSPEYLPPVEESASEAVAVETP----------LADDGYRYKTVRRV-IRRRRDV 159
            : .|:|||||:::.|||||.||..::|...|.|          ||.|||:||||||: .|:||||
  Fly   123 LKYRQRRDVSDIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDV 187

  Fly   160 SELSPEYLPPVEESASEAVAVETP----------LADDGYRYKTVRRV-IRRRRDVSELSPEYLP 213
            ||::.|||||.||..::....|.|          ||.|||:||||||: .|:||||||::.||||
  Fly   188 SEIANEYLPPTEEVVADTPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDVSEIANEYLP 252

  Fly   214 PVEESASEAVAVDTP----------LADDGYRYKTVRRV-IRRRRDVNELPSGEYLPPVEESASE 267
            |.|::|:||...:.|          ||.|||:||||||: .|:||||:|: :.|||||.||..::
  Fly   253 PTEDAATEAPIEEAPVEEASQDSAVLAADGYQYKTVRRLKYRQRRDVSEI-ANEYLPPTEEVVAD 316

  Fly   268 AVAVETP----------LAADGYRYKTVRRV-IRRRRDVNELSAEYLPPVEESASEAVAVETP-- 319
            |...|.|          ||||||:||||||: .|:||||:|::.|||||.||..::|...|.|  
  Fly   317 APVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDVSEIANEYLPPTEEVVADAPVEEVPVE 381

  Fly   320 --------LADDGYRYKTVRRV-IRRRRDVSELSPEYLPPVEESASEAVAVETP----------L 365
                    ||.|||:||||||: .|:||||||::.|||||.||..::|...|.|          |
  Fly   382 EASQDSAVLAADGYQYKTVRRLKYRQRRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVL 446

  Fly   366 ADDGYRYKTVRRV-IRRRRDVSELPSGEYLPPVEETA--SAIIDVPAEQ-----TVLASDGYRYK 422
            |.|||:||||||: .|:||||||: :.|||||.||..  :.:.:||.|:     .|||:|||:||
  Fly   447 AADGYKYKTVRRLKYRQRRDVSEI-ANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYK 510

  Fly   423 TVRRLKLRR 431
            ||||||.|:
  Fly   511 TVRRLKYRQ 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13705NP_647938.1 GYR 49..66 CDD:128953 15/16 (94%)
GYR 417..432 CDD:128953 12/15 (80%)
CG32237NP_729037.1 GYR 56..73 CDD:128953 15/16 (94%)
GYR 168..185 CDD:128953 10/16 (63%)
GYR 224..241 CDD:128953 10/16 (63%)
GYR 336..353 CDD:128953 11/16 (69%)
GYR 448..465 CDD:128953 10/16 (63%)
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CKD8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36135
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.