DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13705 and F11E6.3

DIOPT Version :9

Sequence 1:NP_647938.1 Gene:CG13705 / 38587 FlyBaseID:FBgn0035582 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_503116.1 Gene:F11E6.3 / 178533 WormBaseID:WBGene00008707 Length:345 Species:Caenorhabditis elegans


Alignment Length:343 Identity:107/343 - (31%)
Similarity:129/343 - (37%) Gaps:88/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PSGEYLPPVEESASEAVAVETPLADDGYRYKTVRRVIRRRRD------VSELSPEYLPPVEES-- 128
            ||.......|..|.|..|.|.|..|.|||.|  |:......|      |.|.:|....|||::  
 Worm    47 PSAPAETAPEPVAQEETAPEAPAQDAGYRSK--RQAQNSYGDEAAAPAVEESAPAAEQPVEQAAE 109

  Fly   129 --ASEAVAVETPLADDGYRYKTVRRVIRRRRD-------VSELSPEYLPPVEES----ASEAVAV 180
              |.|..|.|.|..|.|||.|  |:......|       |.|.:|....|||::    |.|..|.
 Worm   110 PVAQEEAAPEAPAQDAGYRSK--RQAQNSYGDEAAAAPAVEESAPAAEQPVEQAAEPVAQEEAAP 172

  Fly   181 ETPLADDGYRYKTVRRVIRRRRD-------VSELSPEYLPPVEES----ASEAVAVDTPLADDGY 234
            |.|..|.|||.|  |:......|       |.|.:|....|||::    |.|..|.:.|..|.||
 Worm   173 EAPAQDAGYRSK--RQAQNSYGDEAAAAPAVEESAPAAEQPVEQAAEPVAQEEAAPEAPAQDAGY 235

  Fly   235 RYKTVRRVIRRRRDVNELPSGEYLPPVEESASEAVAVETPLAADGYRYKTVRRVIRRRRDVNELS 299
            |.|       |:...:........|.|||||.   |.|.|:                     |.:
 Worm   236 RSK-------RQAQNSYGDEAAAAPAVEESAP---AAEQPV---------------------EQA 269

  Fly   300 AEYLPPVEESASEAVAVETPLADDGYRYKTVRRVIRRRRDVSELSP---EYLP----PVEES--- 354
            ||   ||   |.|....|.|..|.|||.|  |:......|.:..:|   |..|    |||::   
 Worm   270 AE---PV---AQEEAVPEAPAQDAGYRSK--RQAQNSYGDEAAAAPAAEESAPAAEQPVEQAAEP 326

  Fly   355 -ASEAVAVETPLADDGYR 371
             |.|..|.|.|..|.|||
 Worm   327 VAQEETAPEAPAQDAGYR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13705NP_647938.1 GYR 49..66 CDD:128953
GYR 417..432 CDD:128953
F11E6.3NP_503116.1 rne <65..237 CDD:236766 58/177 (33%)
PRK07994 <157..341 CDD:236138 67/224 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.