DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32237 and CG11131

DIOPT Version :9

Sequence 1:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_001262228.1 Gene:CG11131 / 40511 FlyBaseID:FBgn0037204 Length:229 Species:Drosophila melanogaster


Alignment Length:307 Identity:123/307 - (40%)
Similarity:155/307 - (50%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLA----CIFIAAATAAVIPVEQARHRRDVSEIVNEYIPPAEEVGAELAQDPAALGDDGYRY 61
            ||||.|    |:...||..:..|..       ..|..:||:||..|  ||.||    |.::||:|
  Fly     1 MKLFTAVLAICLVAFAAAQSADPAA-------ALEPSSEYLPPVGE--AEAAQ----LSENGYKY 52

  Fly    62 KTVRRLKLRQRRDVSEIANEYLPPTEEVVADAPVEEV--PVEEASQDSAVLAADGYQYKTVRRLK 124
            :||||||||.||:|..  .|||||.|    :||.:|.  ||:.|:.....:|.|||:|||||:||
  Fly    53 RTVRRLKLRHRREVPN--QEYLPPVE----NAPSQEYLPPVDAAAIGDTKVADDGYRYKTVRKLK 111

  Fly   125 Y--RQRRDVSDIA---NEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQR 184
            :  |.|||||:||   .|||||            |.||.|.:...:|..||||||||||||:|:.
  Fly   112 FRARHRRDVSEIAEPSGEYLPP------------VQVELAPELKTILGDDGYKYKTVRRLKFRRH 164

  Fly   185 RDVSEIANEYLPPTEEVVADTPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDVSEIANE 249
            |             .|.||         |||:.:|   |.:|                      |
  Fly   165 R-------------REAVA---------EEAAAES---APNG----------------------E 182

  Fly   250 YLPPTEDAATEAPIEEAPVEEASQDSAVLAADGYQYKTVRRLKYRQR 296
            ||||.| ||..||.......:::::...||.|||:|||||||:||.|
  Fly   183 YLPPAE-AAAAAPAAAEAEPKSAEEGTELAKDGYRYKTVRRLRYRYR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32237NP_729037.1 GYR 56..73 CDD:128953 11/16 (69%)
GYR 168..185 CDD:128953 13/16 (81%)
GYR 224..241 CDD:128953 1/16 (6%)
GYR 336..353 CDD:128953
GYR 448..465 CDD:128953
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
CG11131NP_001262228.1 GYR 99..116 CDD:111632 10/16 (63%)
GYR 212..229 CDD:111632 13/17 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.