DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32237 and CG7465

DIOPT Version :10

Sequence 1:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster


Alignment Length:446 Identity:163/446 - (36%)
Similarity:202/446 - (45%) Gaps:165/446 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLACIFIAAATAAVIPVEQARHRRDVSEI-VNEYIPPAEE--------------VGAELAQD 50
            |||||....:.||.||           |||.: .|||:||.:|              |.||.|  
  Fly     1 MKLFLVAFAVIAAVAA-----------DVSHLPSNEYLPPVQEQQIIAGPSNEYLPPVQAESA-- 52

  Fly    51 PA-ALGDDGYRYKTVRRLKLRQ-RRDVSEIANEYLPPTEEVVADAPVEE--VPVEEASQDSAVLA 111
            || .|.||||||||.:|:.:|: ||||:|:.||||||..     ||..|  .|.|.|.:  .:||
  Fly    53 PAHELADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFA-----APSNEYLAPAEGAPE--TILA 110

  Fly   112 ADGYQYKTVRR-LKYRQRRDVSDI-ANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYK 174
            .|||:|||.:| :..|.|||||.: :||||||   |.|.||                        
  Fly   111 DDGYRYKTHKRVVTRRHRRDVSHLPSNEYLPP---VQAAAP------------------------ 148

  Fly   175 TVRRLKYRQRRDVSEIANEYLPPTEEVV-----ADTPVE-EVPVEEASQDSAV--------LAAD 225
                            :||||||....|     |..||: ..||:.|:....|        ||.|
  Fly   149 ----------------SNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAHELADD 197

  Fly   226 GYKYKTVRRLKYRQ-RRDVSEIANEYLPPTEDAATE--APIEEAPVEEASQDSAVLAADGYQYKT 287
            ||:|||.||:.||: ||||:|::||||||....:.|  ||.|.||..:       ||.|||:|||
  Fly   198 GYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAPAETAPETD-------LAVDGYRYKT 255

  Fly   288 VRR-LKYRQRRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQ 351
            .:| :..|.||||:|::||||||    |..||                                 
  Fly   256 HKRVVTRRHRRDVNELSNEYLPP----VQSAP--------------------------------- 283

  Fly   352 RRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYKTVRRLKYRQ 407
                   :.|||.|.|..|..||..            |||.|||.|||.:|:..|:
  Fly   284 -------SAEYLAPQENTVEAAPAH------------VLADDGYVYKTHKRVVLRR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32237NP_729037.1 GYR 56..73 CDD:426962 10/17 (59%)
GYR 113..129 CDD:426962 8/16 (50%)
GYR 169..185 CDD:426962 0/15 (0%)
GYR 225..241 CDD:426962 10/16 (63%)
GYR 281..297 CDD:426962 8/16 (50%)
GYR 337..353 CDD:426962 0/15 (0%)
GYR 393..409 CDD:426962 8/15 (53%)
GYR 449..465 CDD:426962
GYR 505..521 CDD:426962
GYR 561..577 CDD:426962
GYR 617..633 CDD:426962
GYR 673..689 CDD:426962
GYR 729..745 CDD:426962
GYR 785..801 CDD:426962
GYR 841..857 CDD:426962
GYR 892..909 CDD:426962
CG7465NP_647909.1 GYR 111..128 CDD:426962 8/16 (50%)
PRK12757 <128..>193 CDD:237191 29/107 (27%)
GYR 249..265 CDD:426962 8/15 (53%)
GYR 305..321 CDD:426962 8/16 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.