DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32237 and CG7465

DIOPT Version :9

Sequence 1:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster


Alignment Length:446 Identity:163/446 - (36%)
Similarity:202/446 - (45%) Gaps:165/446 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLACIFIAAATAAVIPVEQARHRRDVSEI-VNEYIPPAEE--------------VGAELAQD 50
            |||||....:.||.||           |||.: .|||:||.:|              |.||.|  
  Fly     1 MKLFLVAFAVIAAVAA-----------DVSHLPSNEYLPPVQEQQIIAGPSNEYLPPVQAESA-- 52

  Fly    51 PA-ALGDDGYRYKTVRRLKLRQ-RRDVSEIANEYLPPTEEVVADAPVEE--VPVEEASQDSAVLA 111
            || .|.||||||||.:|:.:|: ||||:|:.||||||..     ||..|  .|.|.|.:  .:||
  Fly    53 PAHELADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFA-----APSNEYLAPAEGAPE--TILA 110

  Fly   112 ADGYQYKTVRR-LKYRQRRDVSDI-ANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYK 174
            .|||:|||.:| :..|.|||||.: :||||||   |.|.||                        
  Fly   111 DDGYRYKTHKRVVTRRHRRDVSHLPSNEYLPP---VQAAAP------------------------ 148

  Fly   175 TVRRLKYRQRRDVSEIANEYLPPTEEVV-----ADTPVE-EVPVEEASQDSAV--------LAAD 225
                            :||||||....|     |..||: ..||:.|:....|        ||.|
  Fly   149 ----------------SNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAHELADD 197

  Fly   226 GYKYKTVRRLKYRQ-RRDVSEIANEYLPPTEDAATE--APIEEAPVEEASQDSAVLAADGYQYKT 287
            ||:|||.||:.||: ||||:|::||||||....:.|  ||.|.||..:       ||.|||:|||
  Fly   198 GYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAPAETAPETD-------LAVDGYRYKT 255

  Fly   288 VRR-LKYRQRRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQ 351
            .:| :..|.||||:|::||||||    |..||                                 
  Fly   256 HKRVVTRRHRRDVNELSNEYLPP----VQSAP--------------------------------- 283

  Fly   352 RRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYKTVRRLKYRQ 407
                   :.|||.|.|..|..||..            |||.|||.|||.:|:..|:
  Fly   284 -------SAEYLAPQENTVEAAPAH------------VLADDGYVYKTHKRVVLRR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32237NP_729037.1 GYR 56..73 CDD:128953 10/17 (59%)
GYR 168..185 CDD:128953 0/16 (0%)
GYR 224..241 CDD:128953 10/17 (59%)
GYR 336..353 CDD:128953 0/16 (0%)
GYR 448..465 CDD:128953
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
CG7465NP_647909.1 GYR 111..128 CDD:128953 8/16 (50%)
GYR 249..265 CDD:128953 8/15 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CKD8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.