DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and SDS22

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 / 853641 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:67/217 - (30%)
Similarity:104/217 - (47%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 VMTSISALEQLSI---KN-KQLSL------SASYGSIF--QQLVFLDLYDNQIERI-ANLDGLPS 493
            |...|.:||.|::   || |||.|      |.|...:.  .::|.||.|||:|:.| :|::.|..
Yeast    50 VHLKIKSLEDLNLYRFKNLKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTK 114

  Fly   494 LSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQINQQDF 558
            |:.|.|..|:|..|..|.:|.| |..|....|.::.: ..::.|:.||:|.|.||::..|....|
Yeast   115 LTSLDLSFNKIKHIKNLENLTD-LENLYFVQNSISKI-ENLSTLKSLKNLELGGNKVHSIEPDSF 177

  Fly   559 LGLRCLRE----------------------LNLKRNKLRRINGFQHLVALERLWLCHNDLHRVDD 601
            .||..|.|                      |:::.|||::|...:.|..||.|:|.||.:.:::.
Yeast   178 EGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEG 242

  Fly   602 MASIARATRLLEVTIENNPVSL 623
            :....:.| .|:|| .|...||
Yeast   243 LEKNLKLT-TLDVT-SNKITSL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380 11/33 (33%)
PPP1R42 467..661 CDD:455733 54/182 (30%)
leucine-rich repeat 472..493 CDD:275380 10/21 (48%)
leucine-rich repeat 494..516 CDD:275380 8/21 (38%)
leucine-rich repeat 517..539 CDD:275380 4/21 (19%)
leucine-rich repeat 540..563 CDD:275380 10/22 (45%)
leucine-rich repeat 564..585 CDD:275380 8/42 (19%)
leucine-rich repeat 611..637 CDD:275380 6/13 (46%)
SDS22NP_012728.1 leucine-rich repeat 44..67 CDD:275380 5/16 (31%)
PPP1R42 <49..169 CDD:455733 42/120 (35%)
leucine-rich repeat 68..91 CDD:275380 6/22 (27%)
leucine-rich repeat 92..114 CDD:275380 10/21 (48%)
PPP1R42 112..332 CDD:455733 45/155 (29%)
leucine-rich repeat 115..136 CDD:275380 8/20 (40%)
leucine-rich repeat 137..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..182 CDD:275380 10/22 (45%)
leucine-rich repeat 183..204 CDD:275380 2/20 (10%)
leucine-rich repeat 205..248 CDD:275380 12/42 (29%)
leucine-rich repeat 249..270 CDD:275380 7/16 (44%)
leucine-rich repeat 271..294 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.