DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and LRRC61

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_076431.1 Gene:LRRC61 / 65999 HGNCID:21704 Length:259 Species:Homo sapiens


Alignment Length:160 Identity:48/160 - (30%)
Similarity:71/160 - (44%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 ESPSVMTSISALEQLSIKNKQLSLSASYGSIFQQLVFLDLYDNQIERIANLDGLPSLSVLLLGKN 502
            |.|.....:....|| :|::....|      .:.::.|.|....:..:..|.....|..|.|..|
Human     6 EKPGEAGGLQITPQL-LKSRTGEFS------LESILLLKLRGLGLADLGCLGECLGLEWLDLSGN 63

  Fly   503 RITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQINQ-QDFLGLRCLRE 566
            .:|.:|.|:||:. |.||::..|:||.|.....| :.|:|||.|||.:....| |...||.||..
Human    64 ALTHLGPLASLRQ-LAVLNVSNNRLTGLEPLATC-ENLQSLNAAGNLLATPGQLQCLAGLPCLEY 126

  Fly   567 LNLKRNKLRRINGFQHLVALERLWLCHNDL 596
            |.| |:.|.|::  ..|.|....|....:|
Human   127 LRL-RDPLARLS--NPLCANPSYWAAVREL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380 4/21 (19%)
PPP1R42 467..661 CDD:455733 42/131 (32%)
leucine-rich repeat 472..493 CDD:275380 3/20 (15%)
leucine-rich repeat 494..516 CDD:275380 9/21 (43%)
leucine-rich repeat 517..539 CDD:275380 8/21 (38%)
leucine-rich repeat 540..563 CDD:275380 11/23 (48%)
leucine-rich repeat 564..585 CDD:275380 7/20 (35%)
leucine-rich repeat 611..637 CDD:275380
LRRC61NP_076431.1 LRR 1 32..53 3/20 (15%)
LRR 2 54..75 8/20 (40%)
leucine-rich repeat 55..76 CDD:275380 9/20 (45%)
PPP1R42 <71..165 CDD:455733 33/88 (38%)
LRR 3 76..97 8/22 (36%)
leucine-rich repeat 77..98 CDD:275380 8/21 (38%)
LRR 4 98..119 9/20 (45%)
leucine-rich repeat 99..123 CDD:275380 11/23 (48%)
leucine-rich repeat 124..149 CDD:275380 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.