DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13708 and CG10839

DIOPT Version :9

Sequence 1:	NP_001261433.1	Gene:	CG13708 / 38582	FlyBaseID:	FBgn0035577	Length:	1301	Species:	Drosophila melanogaster
Sequence 2:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster

Alignment Length:	140	Identity:	37/140 - (26%)
Similarity:	65/140 - (46%)	Gaps:	30/140 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   534 INCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQHLV-ALERLWLCHNDLH 597
            :|.|.:.:.|:|:.|.|.:|.  ...|::.|:.|:|.||.|:.:||.:.|. .||.||:.:|::.
  Fly    44 LNSLTECQKLSLSSNMIEKIT--GISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIE 106

  Fly   598 RVDDMASIARATR-----------------------LLEVTIENNPVSLAGDCVSF---LVSYLP 636
            :...:.|: :|.|                       |.|:|...||::...|..:|   .|..||
  Fly   107 KTKPLESM-KALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLP 170

  Fly   637 LLQTLSQMPI 646
            .::.|...|:
  Fly   171 NMKKLDGEPV 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13708	NP_001261433.1	LRR_RI	<428..572	CDD:238064	11/37 (30%)
		leucine-rich repeat	449..471	CDD:275380
		leucine-rich repeat	472..493	CDD:275380
		LRR_8	475..527	CDD:290566
		leucine-rich repeat	494..516	CDD:275380
		LRR_8	516..574	CDD:290566	13/39 (33%)
		leucine-rich repeat	517..539	CDD:275380	2/4 (50%)
		leucine-rich repeat	540..563	CDD:275380	6/22 (27%)
		LRR_4	564..604	CDD:289563	14/40 (35%)
		leucine-rich repeat	564..585	CDD:275380	9/21 (43%)
		leucine-rich repeat	611..637	CDD:275380	9/28 (32%)
		LRR_9	<1059..1153	CDD:258718
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	25/87 (29%)
		LRR_4	48..90	CDD:289563	14/43 (33%)
		leucine-rich repeat	50..71	CDD:275380	6/22 (27%)
		LRR_8	51..105	CDD:290566	20/55 (36%)
		leucine-rich repeat	72..94	CDD:275380	9/21 (43%)
		leucine-rich repeat	95..116	CDD:275380	6/21 (29%)
		leucine-rich repeat	117..141	CDD:275380	1/23 (4%)
		leucine-rich repeat	142..171	CDD:275380	9/28 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.810