DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and Dnaaf11

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:XP_038934705.1 Gene:Dnaaf11 / 299920 RGDID:1559937 Length:486 Species:Rattus norvegicus


Alignment Length:503 Identity:101/503 - (20%)
Similarity:170/503 - (33%) Gaps:155/503 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 ISALEQLSIKNKQLSLSASYGSIFQQLVFLDLYDNQIERIANLDGLPSLSVLLLGKNRITDIGGL 510
            |.:||:||:..:::..........:.|..|.|.:|.|.:|.|:..|..|..|.|..|.|.     
  Rat    34 IFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIAKIENVSKLKKLEYLNLALNNIE----- 93

  Fly   511 SSLKDTLRVLDLHGNK-LTSLGSRINCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKL 574
                   |:.:|.|.: ||.|...:|.:.:|.|:....:.|.            ||||.|..|..
  Rat    94 -------RIENLEGCEWLTKLDLTVNFIGELSSIKTLTHNIH------------LRELFLVGNPC 139

  Fly   575 RRINGFQH--LVALERL-WLCHNDLHRVDDMASI-------------------------ARATRL 611
            ...:|::.  :|.|::| ||...::.|.:.:.::                         ..|.|.
  Rat   140 ADFDGYREFVVVTLQQLKWLDGKEIERSERIQALQNYAAVEQQIREQEKAYCLRRAKEKEEAQRK 204

  Fly   612 LEVTIEN-----NPVSLAGDCVSFLVSYLPLLQTLSQMPITEQVRRAALAWRQHKEQAQAAPGSS 671
            ||...|:     :.....|||.:.:.:..|     |.|              ::|:..| .|.:.
  Rat   205 LEEENESEDKKKSSPGFDGDCYTDIHADCP-----SAM--------------ENKDHLQ-VPETQ 249

  Fly   672 EAYHNIRREEVISNARTNWELLRSQQTVVGRPKSRLTSELAKINESNEGPAGEEGEMESEESQQP 736
            |..|:.::.:.|.:....|     .:..:..|:|||                 |.....|:.::.
  Rat   250 EQQHSTKKSDEIEDDLAFW-----NKPSLFTPESRL-----------------ETLRHMEKQRKA 292

  Fly   737 KELMDELQALIKLPPIAKDLRNPHEEDGASSEASSLGPNVDSCSSCYSSDNEDGGAKNKPQTPQI 801
            ::.:.|.:..:| ||     |....|||...       ||:.....:|..:              
  Rat   293 QDKLSEKKKRVK-PP-----RTLITEDGKVL-------NVNEAKLDFSLKD-------------- 330

  Fly   802 DENSNKV------------GLTE---KPPSSPVTVASQSPEVAIVTPSAPVSSSPSPPALT---- 847
            ||..|::            .|.|   :|....|.|..:..::|:.....|.|||......|    
  Rat   331 DEKHNQIILDLAVYRYMDTSLIEVDVQPTYVRVMVKGKPFQLALSAEVQPDSSSAKRSQTTGHLL 395

  Fly   848 LTPPAAPGTPVPGTTSPSPSTTIISTLPVPATASSNASRPTSSKQRSR 895
            :..|.. |..:.|..:|....|        |:.||........||..|
  Rat   396 ICMPKV-GEMITGQQTPMSVKT--------ASESSKEQTKPRRKQVER 434

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380 4/21 (19%)
PPP1R42 467..661 CDD:455733 47/227 (21%)
leucine-rich repeat 472..493 CDD:275380 8/20 (40%)
leucine-rich repeat 494..516 CDD:275380 5/21 (24%)
leucine-rich repeat 517..539 CDD:275380 7/22 (32%)
leucine-rich repeat 540..563 CDD:275380 3/22 (14%)
leucine-rich repeat 564..585 CDD:275380 7/22 (32%)
leucine-rich repeat 611..637 CDD:275380 6/30 (20%)