DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and LRGUK

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_001352629.1 Gene:LRGUK / 136332 HGNCID:21964 Length:1131 Species:Homo sapiens


Alignment Length:50 Identity:13/50 - (26%)
Similarity:20/50 - (40%) Gaps:13/50 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AEELPVKVTGNEMTLAAEAAASSFKSSAGEAAQGAKSWADWATSKIRHLG 71
            |:.||:|    ::...|.|.:.||     .|.....::..|.    |.||
Human    89 AKTLPLK----KIPCKASAPSGSF-----FARDNTANFLSWC----RDLG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380
PPP1R42 467..661 CDD:455733
leucine-rich repeat 472..493 CDD:275380
leucine-rich repeat 494..516 CDD:275380
leucine-rich repeat 517..539 CDD:275380
leucine-rich repeat 540..563 CDD:275380
leucine-rich repeat 564..585 CDD:275380
leucine-rich repeat 611..637 CDD:275380
LRGUKNP_001352629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..96 4/10 (40%)
LRR 1 129..149
leucine-rich repeat 131..150 CDD:275380
PPP1R42 <132..181 CDD:455733
LRR 2 150..171
leucine-rich repeat 151..172 CDD:275380
LRR 3 172..193
leucine-rich repeat 173..194 CDD:275380
PPP1R42 176..369 CDD:455733
LRR 4 194..215
leucine-rich repeat 195..216 CDD:275380
LRR 5 216..237
leucine-rich repeat 217..238 CDD:275380
LRR 6 238..259
leucine-rich repeat 258..281 CDD:275380
LRR 7 260..280
LRR 8 281..302
leucine-rich repeat 282..300 CDD:275380
LRR 9 303..324
leucine-rich repeat 304..328 CDD:275380
GMPK 416..592 CDD:238026
PHA03247 <784..1126 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.