| Sequence 1: | NP_647933.1 | Gene: | CG13708 / 38582 | FlyBaseID: | FBgn0035577 | Length: | 1301 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_320563.5 | Gene: | LOC1280701 / 1280701 | VectorBaseID: | AGAMI1_007157 | Length: | 473 | Species: | Anopheles gambiae |
| Alignment Length: | 32 | Identity: | 9/32 - (28%) |
|---|---|---|---|
| Similarity: | 16/32 - (50%) | Gaps: | 1/32 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 AIIFTVSMVMTMVSAEELPVKVTGNEMTLAAE 39 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13708 | NP_647933.1 | leucine-rich repeat | 449..471 | CDD:275380 | |
| PPP1R42 | 467..661 | CDD:455733 | |||
| leucine-rich repeat | 472..493 | CDD:275380 | |||
| leucine-rich repeat | 494..516 | CDD:275380 | |||
| leucine-rich repeat | 517..539 | CDD:275380 | |||
| leucine-rich repeat | 540..563 | CDD:275380 | |||
| leucine-rich repeat | 564..585 | CDD:275380 | |||
| leucine-rich repeat | 611..637 | CDD:275380 | |||
| LOC1280701 | XP_320563.5 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||