DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and LOC1280701

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:XP_320563.5 Gene:LOC1280701 / 1280701 VectorBaseID:AGAMI1_007157 Length:473 Species:Anopheles gambiae


Alignment Length:32 Identity:9/32 - (28%)
Similarity:16/32 - (50%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AIIFTVSMVMTMVSAEELPVKVTGNEMTLAAE 39
            |:.||..|...:. .::..|:||..|.::..|
Mosquito   281 ALFFTTPMCCALF-PQKTAVEVTKLEASVQKE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380
PPP1R42 467..661 CDD:455733
leucine-rich repeat 472..493 CDD:275380
leucine-rich repeat 494..516 CDD:275380
leucine-rich repeat 517..539 CDD:275380
leucine-rich repeat 540..563 CDD:275380
leucine-rich repeat 564..585 CDD:275380
leucine-rich repeat 611..637 CDD:275380
LOC1280701XP_320563.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.