DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13708 and LRRC23

DIOPT Version :10

Sequence 1:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_964013.1 Gene:LRRC23 / 10233 HGNCID:19138 Length:343 Species:Homo sapiens


Alignment Length:318 Identity:72/318 - (22%)
Similarity:129/318 - (40%) Gaps:78/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 ALEQLSIKNKQLS---LSASYGSIFQQLVFLDLYDNQIE---------------------RIANL 488
            |..:|.:|.:.|:   |..||    ..|.::|:.:|.:.                     |.|.:
Human    70 AYVKLEVKERDLTDIYLLRSY----IHLRYVDISENHLTDLSPLNYLTHLLWLKADGNRLRSAQM 130

  Fly   489 DGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSL-GSRINCLQQLKSLNLAGNQIRQ 552
            :.||.|.:.....|:|||..|:|..:  |..|:|.||.:..: |.....|..|.::.|.|||:  
Human   131 NELPYLQIASFAYNQITDTEGISHPR--LETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQL-- 191

  Fly   553 INQQDFLGLRC--LRELNLKRNKLRRINGFQHLVALERLWLCHNDLHRVDDMASIARATRLLE-V 614
               :..||:..  |:.|.|.:|.|:::.|.:.|..|..|.|..|   ::|.::..:|..:.|: :
Human   192 ---ESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDN---QIDTLSGFSREMKSLQYL 250

  Fly   615 TIENNPVSLAGDCVSFLVSYLPLLQTLSQM--PITEQV--RRAALAWRQHKEQAQAAPGSSEAYH 675
            .:..|.|:..|:...  :..||.|:.|..:  |.|::.  |:.||....:.|:.     ..|.|.
Human   251 NLRGNMVANLGELAK--LRDLPKLRALVLLDNPCTDETSYRQEALVQMPYLERL-----DKEFYE 308

  Fly   676 NIRREEVISNARTNWELLRSQQTVVGRPKSRLTSELAKINESNEGPAGEEGEMESEES 733
            ...|.|.        :::|.                 ::.|..|.....:.::|.|:|
Human   309 EEERAEA--------DVIRQ-----------------RLKEEKEQEPEPQRDLEPEQS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380 6/24 (25%)
PPP1R42 467..661 CDD:455733 54/222 (24%)
leucine-rich repeat 472..493 CDD:275380 6/41 (15%)
leucine-rich repeat 494..516 CDD:275380 7/21 (33%)
leucine-rich repeat 517..539 CDD:275380 7/22 (32%)
leucine-rich repeat 540..563 CDD:275380 7/22 (32%)
leucine-rich repeat 564..585 CDD:275380 7/20 (35%)
leucine-rich repeat 611..637 CDD:275380 5/26 (19%)
LRRC23NP_964013.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
LRR 1 92..113 3/20 (15%)
PPP1R42 <93..163 CDD:455733 16/71 (23%)
leucine-rich repeat 93..114 CDD:275380 3/20 (15%)
LRR 2 114..134 2/19 (11%)
leucine-rich repeat 115..135 CDD:275380 3/19 (16%)
LRR 3 135..155 7/19 (37%)
leucine-rich repeat 136..156 CDD:275380 7/19 (37%)
PPP1R42 146..304 CDD:455733 46/174 (26%)
LRR 4 156..177 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
LRR 5 180..200 7/24 (29%)
leucine-rich repeat 181..201 CDD:275380 7/24 (29%)
LRR 6 201..222 6/20 (30%)
leucine-rich repeat 202..223 CDD:275380 7/20 (35%)
Interaction with RSPH9. /evidence=ECO:0000269|PubMed:38091523 208..343 34/169 (20%)
leucine-rich repeat 224..246 CDD:275380 6/24 (25%)
leucine-rich repeat 247..271 CDD:275380 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..343 6/41 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.