DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and yddK

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:YP_009518781.1 Gene:yddK / 947312 ECOCYCID:G6772 Length:318 Species:Escherichia coli


Alignment Length:351 Identity:84/351 - (23%)
Similarity:159/351 - (45%) Gaps:61/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PKSKANGHNDGDVNGGEINAMS-------HLANFDLVKRVRQIESRLRSVEQPVWHLATGSQIEW 146
            |:.|....||..:  ..:||.:       :|:|.:|:. ...|:..:.|  :.:||:        
E. coli    11 PRMKTITLNDNHI--AHLNAKNTTKLEYLNLSNNNLLP-TNDIDQLISS--KHLWHV-------- 62

  Fly   147 NHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELD 211
              ..:|:   |.|..:...:.|.::::    :...|.|.||||...|:|...    ||.....::
E. coli    63 --LVNGI---NNDPLAQMQYWTAVRNI----IDDTNEVTIDLSGLNLTTQPP----GLQNFTSIN 114

  Fly   212 ISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHA 276
            :.:|  .|..||. .:.|.|:.|.:.:|.||.|:   |.:.||::|..:|.|...:....|    
E. coli   115 LDNN--QFTHFDA-TNYDRLVKLSLNSNALESIN---FPQGRNVSITHISMNNNALRNIDI---- 169

  Fly   277 QRL---TVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIA 338
            .||   |..:...||::...   |.....|:.|::|.|:::::.:|:   ..:|..||...|::.
E. coli   170 DRLSSVTYFSAAHNQLEFVQ---LESCEWLQYLNLSHNQLTDIVAGN---KNELLLLDLSHNKLT 228

  Fly   339 KIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELF 403
            .:.:|.|.   :|.||.::||.:|.:. ..::|..|:.||:...|::.:|:.:....|.::..|.
E. coli   229 SLHNDLFP---NLNTLLINNNLLSEIK-IFYSNFCNVQTLNAANNQLKYINLDFLTYLPSIKSLR 289

  Fly   404 LGQNSMSSIPADLFLNVSALTRLTLF 429
            |..|.::.|..:   |.|.:.  |||
E. coli   290 LDNNKITHIDTN---NTSDIG--TLF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 18/58 (31%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 48/187 (26%)
leucine-rich repeat 207..230 CDD:275380 4/22 (18%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 16/62 (26%)
leucine-rich repeat 255..278 CDD:275380 4/22 (18%)
leucine-rich repeat 279..302 CDD:275380 5/25 (20%)
LRR_8 303..361 CDD:290566 16/57 (28%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
LRR_8 349..407 CDD:290566 15/57 (26%)
LRR_4 350..390 CDD:289563 12/39 (31%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
LRR_8 398..>443 CDD:290566 9/32 (28%)
leucine-rich repeat 399..422 CDD:275380 5/22 (23%)
leucine-rich repeat 423..443 CDD:275380 3/7 (43%)
leucine-rich repeat 471..494 CDD:275380
LRRCT 503..554 CDD:214507
yddKYP_009518781.1 leucine-rich repeat 13..33 CDD:275380 5/21 (24%)
LRR 93..>318 CDD:227223 65/247 (26%)
leucine-rich repeat 110..130 CDD:275380 4/22 (18%)
leucine-rich repeat 131..153 CDD:275380 9/24 (38%)
leucine-rich repeat 154..174 CDD:275380 6/23 (26%)
leucine-rich repeat 175..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..216 CDD:275380 5/22 (23%)
leucine-rich repeat 217..240 CDD:275380 7/25 (28%)
leucine-rich repeat 241..260 CDD:275380 5/19 (26%)
leucine-rich repeat 261..284 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I440
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.