DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LGI1

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_005088.1 Gene:LGI1 / 9211 HGNCID:6572 Length:557 Species:Homo sapiens


Alignment Length:648 Identity:124/648 - (19%)
Similarity:214/648 - (33%) Gaps:218/648 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NACESLGIVSQLLMLINSMPNGTQSAANDKKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKRV 121
            |||..|..::..|.|::::     .....|||.|.|                             
Human    11 NACIPLKRIAYFLCLLSAL-----LLTEGKKPAKPK----------------------------- 41

  Fly   122 RQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNI 186
                                       |.: ||.|..|  :..|  .|.:|:|.|  :|.:::::
Human    42 ---------------------------CPA-VCTCTKD--NALC--ENARSIPRT--VPPDVISL 72

  Fly   187 DLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWK 251
            ...|:..:.:.:.:|.....|:.|..:.|..|.:..|.|..|..|..|.|:||.::.|...||..
Human    73 SFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRG 137

  Fly   252 LRNLNILDLSKNEIGMLPESIFYHAQRLTVINM------CDNQIQNFPPNLLRDQLMLEEL---- 306
            |::|..|.|:.|.:..||:.||.....||.:::      ||.:::.....|......:|::    
Human   138 LKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEG 202

  Fly   307 --DMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIF 369
              :..:.||:.|||         |..|....:.||..|..:..| |:.|.|..|:....::....
Human   203 PPEYKKRKINSLSS---------KDFDCIITEFAKSQDLPYQSL-SIDTFSYLNDEYVVIAQPFT 257

  Fly   370 NNLANLV--TLDLTTNRISHIDGNAFVELNNL---NELFLGQNSMSSIPADLFLNVSALTRLTLF 429
            .....|.  .::.|.....:|.|.:.|....:   .:|::       |.|.|| ..|.:.:...|
Human   258 GKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYV-------IVAQLF-GGSHIYKRDSF 314

  Fly   430 SNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKL-----------MF 483
            :|.        |..:.:::||    .|.|..|...|:..:....:..||:|.           .|
Human   315 ANK--------FIKIQDIEIL----KIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGF 367

  Fly   484 LPHGALHGLKNLVAVKLDKNPWHCDCRALYLA-------------------------RW------ 517
            ..|.:||.             |:.|....||.                         :|      
Human   368 YSHQSLHA-------------WYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQL 419

  Fly   518 ---------------IREFVLKLWDGQQPMC--RGPGDLGGHEVGLLRYDDLCDGQWASMLSLSP 565
                           ::.|.:|   |...:|  |..||....:.|...:.|:            .
Human   420 FTNQTDIPNMEDVYAVKHFSVK---GDVYICLTRFIGDSKVMKWGGSSFQDI------------Q 469

  Fly   566 RLPVRKHQISTPMNYTDYFNLYL------KHIYNGTTDE----ELKEADI------TSVSIKK 612
            |:|.|...:..|:...:|....|      ..:||...::    :.:|.::      |.|||.|
Human   470 RMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 14/58 (24%)
leucine-rich repeat 187..206 CDD:275380 2/18 (11%)
LRR_RI <201..386 CDD:238064 48/198 (24%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR_8 253..313 CDD:290566 14/71 (20%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 5/28 (18%)
LRR_8 303..361 CDD:290566 16/63 (25%)
leucine-rich repeat 303..326 CDD:275380 6/28 (21%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
LRR_8 349..407 CDD:290566 10/62 (16%)
LRR_4 350..390 CDD:289563 7/41 (17%)
leucine-rich repeat 351..374 CDD:275380 3/22 (14%)
leucine-rich repeat 375..398 CDD:275380 5/24 (21%)
LRR_8 398..>443 CDD:290566 9/47 (19%)
leucine-rich repeat 399..422 CDD:275380 5/25 (20%)
leucine-rich repeat 423..443 CDD:275380 3/19 (16%)
leucine-rich repeat 471..494 CDD:275380 7/33 (21%)
LRRCT 503..554 CDD:214507 14/98 (14%)
LGI1NP_005088.1 leucine-rich repeat 71..92 CDD:275378 2/20 (10%)
LRR_8 91..151 CDD:404697 20/59 (34%)
LRR 1 92..113 6/20 (30%)
leucine-rich repeat 93..116 CDD:275378 7/22 (32%)
LRR 2 116..137 8/20 (40%)
leucine-rich repeat 117..140 CDD:275378 9/22 (41%)
LRR 3 140..161 8/20 (40%)
leucine-rich repeat 141..164 CDD:275378 8/22 (36%)
PCC 146..>221 CDD:188093 18/83 (22%)
leucine-rich repeat 165..177 CDD:275378 2/11 (18%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 225..267 9/42 (21%)
EPTP 225..264 CDD:397689 8/39 (21%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 271..313 10/49 (20%)
EPTP 272..310 CDD:397689 9/45 (20%)
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 317..364 10/58 (17%)
EPTP 317..361 CDD:397689 10/55 (18%)
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 366..415 9/61 (15%)
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 419..462 7/45 (16%)
EPTP 420..459 CDD:397689 7/41 (17%)
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 464..506 9/53 (17%)
EPTP 464..502 CDD:397689 7/49 (14%)
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 510..552 6/23 (26%)
EPTP 510..549 CDD:397689 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.