DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and RLP19

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_179112.1 Gene:RLP19 / 815997 AraportID:AT2G15080 Length:983 Species:Arabidopsis thaliana


Alignment Length:521 Identity:120/521 - (23%)
Similarity:204/521 - (39%) Gaps:112/521 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 CNPD-------------TKSFTCWNTNLKSVPVTQVIPM------------------------NM 183
            |:||             |...:|:::|         ||:                        ::
plant    30 CDPDQSDAILEFKNEFETLEESCFDSN---------IPLKTESWTNNSDCCYWDGIKCDAKFGDV 85

  Fly   184 VNIDLSRNILS---TLHKDTFR--GLTVLKELDISHNVLDF---LPFDLFQDLDSLLVLRIQNNQ 240
            :.:|||.:.|.   ..:...||  .|..|..||:|:|  ||   :|..| :.|.:|..|.:..|.
plant    86 IELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNN--DFIGQIPSSL-ETLSNLTTLDLSRNH 147

  Fly   241 LEDIDHRTFWKLRNLNILDLSKNEI-GMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLE 304
            .......:...|.:|..:|.|.|.. |.:|.|:.| ...||..|:..|......|:.:.:...|.
plant   148 FSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGY-LSHLTSFNLSYNNFSGRVPSSIGNLSYLT 211

  Fly   305 ELDMSRNK-ISELSS--GSIRYLTKLKTLDFGWNQIAKIDDDFFAG--------LRSLRTLSLHN 358
            .|.:|||. ..||.|  ||:.:||.|           .:|.:.|.|        |..|.::.||.
plant   212 TLRLSRNSFFGELPSSLGSLFHLTDL-----------ILDTNHFVGKIPSSLGNLSHLTSIDLHK 265

  Fly   359 NRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMS-SIPADLFLNVSA 422
            |...........||:.|.:..|:.|.|.....::|..||.|:.|.:..|.:| |.|..| ||:..
plant   266 NNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIAL-LNLRK 329

  Fly   423 LTRLTLFSNNLTTLEADDFQGLNNLKIL-LLNNNILKNFDARAFEPLSQLEKLRIDSNKLM-FLP 485
            |:.|:||:|.||.....:...|:|||:. ...|:......:..|. :..|:.:.:::|:|. .|.
plant   330 LSTLSLFNNRLTGTLPSNMSSLSNLKLFDATENHFTGPLPSSLFN-IPSLKTITLENNQLNGSLG 393

  Fly   486 HGALHGLKNLVAVKLDKN----PWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGL 546
            .|.:....||..::|..|    |.|   |::.....::|..|..::.|               ||
plant   394 FGNISSYSNLTVLRLGNNNFRGPIH---RSISKLVNLKELDLSNYNTQ---------------GL 440

  Fly   547 LR---YDDLCDGQWASMLSLSPRLPVRKHQISTPMNYTDYFNLYLKHIYNGTTDEELKEADITSV 608
            :.   :..|...::.::..|:....:..::|.:.....|..:|...|: :.|....|..:.:..:
plant   441 VDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHV-STTNKSSLSNSSLVLI 504

  Fly   609 S 609
            |
plant   505 S 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 20/66 (30%)
leucine-rich repeat 187..206 CDD:275380 7/23 (30%)
LRR_RI <201..386 CDD:238064 56/201 (28%)
leucine-rich repeat 207..230 CDD:275380 10/25 (40%)
leucine-rich repeat 231..254 CDD:275380 4/22 (18%)
LRR_8 253..313 CDD:290566 18/61 (30%)
leucine-rich repeat 255..278 CDD:275380 8/23 (35%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 303..361 CDD:290566 21/68 (31%)
leucine-rich repeat 303..326 CDD:275380 11/25 (44%)
leucine-rich repeat 327..350 CDD:275380 5/30 (17%)
LRR_8 349..407 CDD:290566 15/57 (26%)
LRR_4 350..390 CDD:289563 10/39 (26%)
leucine-rich repeat 351..374 CDD:275380 6/22 (27%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 16/45 (36%)
leucine-rich repeat 399..422 CDD:275380 9/23 (39%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 5/23 (22%)
LRRCT 503..554 CDD:214507 10/57 (18%)
RLP19NP_179112.1 PLN00113 3..>646 CDD:331614 120/521 (23%)
leucine-rich repeat 114..137 CDD:275380 10/25 (40%)
leucine-rich repeat 138..161 CDD:275380 4/22 (18%)
leucine-rich repeat 162..185 CDD:275380 8/23 (35%)
leucine-rich repeat 186..209 CDD:275380 5/22 (23%)
leucine-rich repeat 210..233 CDD:275380 10/22 (45%)
leucine-rich repeat 234..257 CDD:275380 7/33 (21%)
leucine-rich repeat 258..281 CDD:275380 6/22 (27%)
leucine-rich repeat 282..305 CDD:275380 6/22 (27%)
leucine-rich repeat 306..329 CDD:275380 9/23 (39%)
leucine-rich repeat 330..351 CDD:275380 7/20 (35%)
leucine-rich repeat 354..377 CDD:275380 4/23 (17%)
leucine-rich repeat 378..402 CDD:275380 5/23 (22%)
leucine-rich repeat 403..424 CDD:275380 6/23 (26%)
leucine-rich repeat 427..451 CDD:275380 6/38 (16%)
leucine-rich repeat 452..477 CDD:275380 2/24 (8%)
leucine-rich repeat 507..526 CDD:275380
leucine-rich repeat 527..550 CDD:275380
leucine-rich repeat 551..574 CDD:275380
leucine-rich repeat 575..604 CDD:275380
PLN00113 <604..692 CDD:331614
leucine-rich repeat 605..630 CDD:275380
leucine-rich repeat 631..655 CDD:275380
PLN00113 <656..739 CDD:331614
leucine-rich repeat 656..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..722 CDD:275380
leucine-rich repeat 723..795 CDD:275380
leucine-rich repeat 796..819 CDD:275380
PLN00113 <808..962 CDD:331614
leucine-rich repeat 820..843 CDD:275380
leucine-rich repeat 844..867 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.