DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and slit2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_021331524.1 Gene:slit2 / 80353 ZFINID:ZDB-GENE-010306-3 Length:1551 Species:Danio rerio


Alignment Length:507 Identity:122/507 - (24%)
Similarity:195/507 - (38%) Gaps:160/507 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 CTSGV--C--RCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKE 209
            |.:|.  |  :|:....:..|...:|:|||  :.||.|:..:||:.|.|:.:.|..|.|      
Zfish    14 CGAGAQSCPSQCSCSGTAVDCHGQSLRSVP--RNIPRNVERLDLNANNLTKITKADFAG------ 70

  Fly   210 LDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFY 274
                              |.:|.||::..|::..|:...|..|:.|..|.|::|.:.:|||.:|.
Zfish    71 ------------------LKNLRVLQLMENKISSIERGAFQDLQELERLRLNRNNLQVLPELLFL 117

  Fly   275 HAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAK 339
            ...:|..:::.:||||..|....|                    ||    |::|.|...:|||:.
Zfish   118 GTTKLFRLDLSENQIQGIPRKAFR--------------------GS----TEIKNLQLDYNQISC 158

  Fly   340 IDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRI------------------- 385
            |:|..|..||.|..|:|:||.||.||...||::..|.|..|.:|.:                   
Zfish   159 IEDGAFRALRDLEVLTLNNNNISRLSVASFNHMPKLRTFRLHSNNLLCDCNVAWLSDWLRQRPRL 223

  Fly   386 -----------------------------------SH------------------ID--GNAFVE 395
                                               ||                  :|  |....|
Zfish   224 GLYTQCMAPPSLRGHNIAEVQKKEFMCTDFSEGPQSHSSCSVLQCPELCTCSNNVVDCRGKGLTE 288

  Fly   396 L-----NNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLN---------- 445
            :     ..:.|:.|.|||:..|||..|.....|.|:.|.:|.:|.|.:|.||||.          
Zfish   289 IPTNLPETITEIRLEQNSIKIIPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGN 353

  Fly   446 --------------NLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLV 496
                          :|::||||.|.:......:|:.|..|..|.:..|||..:..|....|:.:.
Zfish   354 KITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQNLNLLSLYDNKLQTIAKGTFSSLRAIQ 418

  Fly   497 AVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLR 548
            .:.|.:||:.|||...:||.::::..::....:   |..|..|....:|.::
Zfish   419 TLHLAQNPFMCDCHLKWLADYLQDNPIETSGAR---CTSPRRLANKRIGQIK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 13/58 (22%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 53/238 (22%)
leucine-rich repeat 207..230 CDD:275380 1/22 (5%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 15/59 (25%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
LRR_8 303..361 CDD:290566 18/57 (32%)
leucine-rich repeat 303..326 CDD:275380 2/22 (9%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR_8 349..407 CDD:290566 23/136 (17%)
LRR_4 350..390 CDD:289563 18/113 (16%)
leucine-rich repeat 351..374 CDD:275380 11/22 (50%)
leucine-rich repeat 375..398 CDD:275380 9/101 (9%)
LRR_8 398..>443 CDD:290566 17/44 (39%)
leucine-rich repeat 399..422 CDD:275380 9/22 (41%)
leucine-rich repeat 423..443 CDD:275380 8/19 (42%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
LRRCT 503..554 CDD:214507 11/46 (24%)
slit2XP_021331524.1 LRRNT 21..51 CDD:214470 10/31 (32%)
leucine-rich repeat 32..49 CDD:275380 7/18 (39%)
LRR_8 48..108 CDD:316378 20/83 (24%)
leucine-rich repeat 50..73 CDD:275380 8/46 (17%)
leucine-rich repeat 74..97 CDD:275380 7/22 (32%)
LRR_8 97..156 CDD:316378 21/82 (26%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
leucine-rich repeat 122..145 CDD:275380 9/46 (20%)
LRR_8 144..204 CDD:316378 26/59 (44%)
leucine-rich repeat 146..169 CDD:275380 9/22 (41%)
leucine-rich repeat 170..193 CDD:275380 11/22 (50%)
PCC 175..>237 CDD:188093 13/61 (21%)
leucine-rich repeat 194..320 CDD:275380 18/125 (14%)
LRRNT 267..299 CDD:214470 3/31 (10%)
LRR_8 298..355 CDD:316378 20/56 (36%)
leucine-rich repeat 321..344 CDD:275380 11/22 (50%)
leucine-rich repeat 345..365 CDD:275380 0/19 (0%)
LRR_8 375..427 CDD:316378 13/51 (25%)
leucine-rich repeat 393..416 CDD:275380 7/22 (32%)
PCC 398..>461 CDD:188093 16/65 (25%)
LRRNT 507..537 CDD:214470
leucine-rich repeat 517..535 CDD:275380
leucine-rich repeat 539..561 CDD:275380
LRR_8 560..620 CDD:316378
leucine-rich repeat 562..585 CDD:275380
leucine-rich repeat 586..609 CDD:275380
LRR_8 609..668 CDD:316378
leucine-rich repeat 610..633 CDD:275380
leucine-rich repeat 634..657 CDD:275380
PCC 639..>716 CDD:188093
leucine-rich repeat 658..780 CDD:275380
leucine-rich repeat 677..728 CDD:275380
NEL <698..>863 CDD:330839
leucine-rich repeat 736..757 CDD:275380
LRR_8 780..839 CDD:316378
leucine-rich repeat 781..804 CDD:275380
leucine-rich repeat 805..828 CDD:275380
leucine-rich repeat 829..850 CDD:275380
PCC 834..>1026 CDD:188093
EGF 1015..1042 CDD:306513
EGF_CA 1060..1096 CDD:238011
EGF_CA 1098..1134 CDD:238011
Laminin_G_2 1210..1338 CDD:308045
GHB_like 1489..1550 CDD:328788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.