| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001255213.1 | Gene: | LRRC8E / 80131 | HGNCID: | 26272 | Length: | 796 | Species: | Homo sapiens |
| Alignment Length: | 305 | Identity: | 85/305 - (27%) |
|---|---|---|---|
| Similarity: | 145/305 - (47%) | Gaps: | 26/305 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 204 LTVLKELDISHNVLDFLPFDLFQDL-DSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGM 267
Fly 268 LPESIFYHA--------QRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYL 324
Fly 325 TKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTI-FNNLANLVTLDLTTNRISHI 388
Fly 389 DGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQG-LNNLKILLL 452
Fly 453 NNNILKNFDARAFEPLSQLEKLRIDSNKLMFL-PH-GALHGLKNL 495 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | 14/37 (38%) |
| leucine-rich repeat | 187..206 | CDD:275380 | 1/1 (100%) | ||
| LRR_RI | <201..386 | CDD:238064 | 49/191 (26%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 253..313 | CDD:290566 | 13/67 (19%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 6/30 (20%) | ||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 303..361 | CDD:290566 | 13/57 (23%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 349..407 | CDD:290566 | 17/58 (29%) | ||
| LRR_4 | 350..390 | CDD:289563 | 13/40 (33%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 13/44 (30%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 11/24 (46%) | ||
| LRRCT | 503..554 | CDD:214507 | |||
| LRRC8E | NP_001255213.1 | Pannexin_like | 1..331 | CDD:289311 | |
| leucine-rich repeat | 486..508 | CDD:275380 | 6/22 (27%) | ||
| LRR 1 | 508..529 | 6/24 (25%) | |||
| leucine-rich repeat | 509..527 | CDD:275380 | 5/21 (24%) | ||
| LRR_RI | 520..760 | CDD:238064 | 62/238 (26%) | ||
| LRR 2 | 536..557 | 4/21 (19%) | |||
| leucine-rich repeat | 537..559 | CDD:275380 | 4/22 (18%) | ||
| LRR 3 | 559..579 | 3/19 (16%) | |||
| leucine-rich repeat | 560..583 | CDD:275380 | 4/22 (18%) | ||
| LRR 4 | 583..604 | 4/21 (19%) | |||
| LRR_8 | 584..642 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 584..606 | CDD:275380 | 5/22 (23%) | ||
| LRR 5 | 606..627 | 5/20 (25%) | |||
| leucine-rich repeat | 607..631 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 630..688 | CDD:290566 | 19/59 (32%) | ||
| LRR 6 | 631..652 | 7/21 (33%) | |||
| leucine-rich repeat | 632..654 | CDD:275380 | 8/22 (36%) | ||
| LRR 7 | 654..675 | 7/21 (33%) | |||
| leucine-rich repeat | 655..677 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 676..734 | CDD:290566 | 18/60 (30%) | ||
| LRR 8 | 677..698 | 6/22 (27%) | |||
| leucine-rich repeat | 678..700 | CDD:275380 | 7/23 (30%) | ||
| LRR 9 | 700..721 | 7/21 (33%) | |||
| leucine-rich repeat | 701..723 | CDD:275380 | 6/22 (27%) | ||
| LRR 10 | 723..744 | 8/20 (40%) | |||
| leucine-rich repeat | 724..746 | CDD:275380 | 10/21 (48%) | ||
| LRR 11 | 746..767 | 2/5 (40%) | |||
| leucine-rich repeat | 747..767 | CDD:275380 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||