DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LRRTM4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001317299.1 Gene:LRRTM4 / 80059 HGNCID:19411 Length:591 Species:Homo sapiens


Alignment Length:436 Identity:103/436 - (23%)
Similarity:176/436 - (40%) Gaps:88/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LANFDLVKRVRQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVT 176
            :..|.|:.:::.:...|..:...:..:.||:|   ..|... |||  |.|...|.:.....:|  
Human     1 MPGFHLITQLKGMSVVLVLLPTLLLVMLTGAQ---RACPKN-CRC--DGKIVYCESHAFADIP-- 57

  Fly   177 QVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQL 241
            :.|......:.|..|.:..|..:.|.||..|..|.:.||.:..:..|.||.:..|..|.:.:|::
Human    58 ENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSSNKI 122

  Fly   242 EDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEEL 306
            ..:.::||..:.||..||||.|::..|....|...::|.::::..|.::..|..:.:|...|:.|
Human   123 TYLHNKTFHPVPNLRNLDLSYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFL 187

  Fly   307 DMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNN 371
            |:..|::..||..:...|.|||.|....||.:||:...|..|.:||::.|..|||.|:|..:...
Human   188 DLGYNRLRSLSRNAFAGLLKLKELHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWT 252

  Fly   372 LANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTL 436
            .::|..|||:.|                                                     
Human   253 WSSLHNLDLSGN----------------------------------------------------- 264

  Fly   437 EADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLD 501
               |.||:                :...|:.|..|:||.:|||||..:....::...:|:::.|.
Human   265 ---DIQGI----------------EPGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISITLS 310

  Fly   502 KNPWHCDCRALYLARWIREFVLKLWDGQQP---MCRGPGDLGGHEV 544
            .|.|.|......|..|::.|     .|.:.   :|.||..:.|.:|
Human   311 GNMWECSRSICPLFYWLKNF-----KGNKESTMICAGPKHIQGEKV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 58/184 (32%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 17/59 (29%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 303..361 CDD:290566 21/57 (37%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR_8 349..407 CDD:290566 13/57 (23%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
LRR_8 398..>443 CDD:290566 1/44 (2%)
leucine-rich repeat 399..422 CDD:275380 0/22 (0%)
leucine-rich repeat 423..443 CDD:275380 1/19 (5%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
LRRCT 503..554 CDD:214507 12/45 (27%)
LRRTM4NP_001317299.1 leucine-rich repeat 44..62 CDD:275380 4/19 (21%)
leucine-rich repeat 65..87 CDD:275380 6/21 (29%)
LRR_RI <85..291 CDD:238064 68/277 (25%)
LRR_8 87..146 CDD:290566 19/58 (33%)
leucine-rich repeat 88..111 CDD:275380 7/22 (32%)
leucine-rich repeat 112..135 CDD:275380 5/22 (23%)
LRR_8 134..194 CDD:290566 17/59 (29%)
leucine-rich repeat 136..159 CDD:275380 8/22 (36%)
leucine-rich repeat 160..183 CDD:275380 4/22 (18%)
leucine-rich repeat 184..207 CDD:275380 7/22 (32%)
leucine-rich repeat 208..231 CDD:275380 9/22 (41%)
LRR_8 231..290 CDD:290566 24/130 (18%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
leucine-rich repeat 256..279 CDD:275380 10/94 (11%)
leucine-rich repeat 304..316 CDD:275378 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.