| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598672.1 | Gene: | Adgra3 / 70693 | MGIID: | 1917943 | Length: | 1310 | Species: | Mus musculus |
| Alignment Length: | 266 | Identity: | 66/266 - (24%) |
|---|---|---|---|
| Similarity: | 95/266 - (35%) | Gaps: | 102/266 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 290 QNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTL 354
Fly 355 SLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLN 419
Fly 420 VSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFL 484
Fly 485 PHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRY 549
Fly 550 DDL-CD 554 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 40/95 (42%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 7/22 (32%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/11 (36%) | ||
| LRR_8 | 303..361 | CDD:290566 | 26/57 (46%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 349..407 | CDD:290566 | 20/57 (35%) | ||
| LRR_4 | 350..390 | CDD:289563 | 16/39 (41%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 0/44 (0%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 0/19 (0%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 3/22 (14%) | ||
| LRRCT | 503..554 | CDD:214507 | 13/51 (25%) | ||
| Adgra3 | NP_598672.1 | LRR 1 | 71..92 | 10/22 (45%) | |
| leucine-rich repeat | 72..95 | CDD:275378 | 11/24 (46%) | ||
| LRR_RI | <73..155 | CDD:238064 | 38/91 (42%) | ||
| LRR_8 | 74..130 | CDD:290566 | 26/55 (47%) | ||
| LRR 2 | 95..116 | 7/20 (35%) | |||
| leucine-rich repeat | 96..119 | CDD:275378 | 9/22 (41%) | ||
| LRR_8 | 118..171 | CDD:290566 | 25/124 (20%) | ||
| LRR_4 | 119..158 | CDD:289563 | 19/46 (41%) | ||
| LRR 3 | 119..140 | 10/20 (50%) | |||
| leucine-rich repeat | 120..143 | CDD:275378 | 10/22 (45%) | ||
| LRR 4 | 143..164 | 12/92 (13%) | |||
| leucine-rich repeat | 144..167 | CDD:275378 | 12/94 (13%) | ||
| LRRCT | 178..>212 | CDD:214507 | 12/60 (20%) | ||
| IG_like | 238..330 | CDD:214653 | |||
| Ig | 242..326 | CDD:299845 | |||
| HRM | <352..405 | CDD:280888 | |||
| GPS | 688..732 | CDD:280071 | |||
| 7tm_4 | 751..>934 | CDD:304433 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1065..1084 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1187..1208 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1221..1264 | ||||
| PDZ-binding. /evidence=ECO:0000255 | 1308..1310 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||