| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102978.1 | Gene: | Lrfn4 / 688721 | RGDID: | 1585286 | Length: | 636 | Species: | Rattus norvegicus |
| Alignment Length: | 295 | Identity: | 78/295 - (26%) |
|---|---|---|---|
| Similarity: | 114/295 - (38%) | Gaps: | 63/295 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 293 PPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLH 357
Fly 358 NNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVE-LNNLNELFLGQNSMSSIPADLFLNVS 421
Fly 422 ALTRLTLFSNNLTTLEADDFQGLNN---LKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMF 483
Fly 484 LPHGAL-------HGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGG 541
Fly 542 HEVGLLRYDDLCDGQWA---SMLSLSPRLPVRKHQ 573 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 31/92 (34%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 7/19 (37%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/8 (50%) | ||
| LRR_8 | 303..361 | CDD:290566 | 20/57 (35%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 349..407 | CDD:290566 | 19/58 (33%) | ||
| LRR_4 | 350..390 | CDD:289563 | 14/39 (36%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 4/44 (9%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 0/19 (0%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 7/29 (24%) | ||
| LRRCT | 503..554 | CDD:214507 | 16/50 (32%) | ||
| Lrfn4 | NP_001102978.1 | LRR 1 | 49..70 | 5/23 (22%) | |
| leucine-rich repeat | 50..73 | CDD:275380 | 6/25 (24%) | ||
| PPP1R42 | 53..203 | CDD:411060 | 45/176 (26%) | ||
| LRR 2 | 73..94 | 6/20 (30%) | |||
| leucine-rich repeat | 74..97 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 97..118 | 8/20 (40%) | |||
| leucine-rich repeat | 98..121 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 121..142 | 8/20 (40%) | |||
| leucine-rich repeat | 122..146 | CDD:275380 | 8/23 (35%) | ||
| LRR 5 | 146..169 | 5/49 (10%) | |||
| leucine-rich repeat | 147..170 | CDD:275380 | 5/49 (10%) | ||
| LRR 6 | 170..191 | 5/20 (25%) | |||
| leucine-rich repeat | 171..194 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 194..215 | 8/20 (40%) | |||
| leucine-rich repeat | 195..213 | CDD:275380 | 6/17 (35%) | ||
| LRRCT | 234..278 | CDD:214507 | 18/62 (29%) | ||
| Ig | 281..368 | CDD:416386 | 3/8 (38%) | ||
| Ig strand A | 281..284 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 288..291 | CDD:409353 | 1/1 (100%) | ||
| Ig strand B | 297..305 | CDD:409353 | |||
| Ig strand C | 311..316 | CDD:409353 | |||
| Ig strand C' | 319..321 | CDD:409353 | |||
| Ig strand D | 327..331 | CDD:409353 | |||
| Ig strand E | 334..338 | CDD:409353 | |||
| Ig strand F | 348..355 | CDD:409353 | |||
| Ig strand G | 358..368 | CDD:409353 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 556..585 | ||||
| PDZ-binding | 633..636 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||