Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_075689.1 | Gene: | Ppp1r7 / 66385 | MGIID: | 1913635 | Length: | 361 | Species: | Mus musculus |
Alignment Length: | 335 | Identity: | 86/335 - (25%) |
---|---|---|---|
Similarity: | 153/335 - (45%) | Gaps: | 70/335 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 IPMNMVNIDLSRNILSTLHK--DTFRGLTVLKE---LDISHNVLDFLPFDLFQDLDSLLVLRIQN 238
Fly 239 NQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLML 303
Fly 304 EELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTI 368
Fly 369 FNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNL 433
Fly 434 TTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAV 498
Fly 499 KLDKNPWHCD 508 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | 15/63 (24%) |
leucine-rich repeat | 187..206 | CDD:275380 | 4/20 (20%) | ||
LRR_RI | <201..386 | CDD:238064 | 50/187 (27%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 253..313 | CDD:290566 | 12/59 (20%) | ||
leucine-rich repeat | 255..278 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 2/22 (9%) | ||
LRR_8 | 303..361 | CDD:290566 | 18/57 (32%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 349..407 | CDD:290566 | 20/57 (35%) | ||
LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 351..374 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 375..398 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 398..>443 | CDD:290566 | 14/44 (32%) | ||
leucine-rich repeat | 399..422 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 423..443 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 471..494 | CDD:275380 | 3/22 (14%) | ||
LRRCT | 503..554 | CDD:214507 | 3/6 (50%) | ||
Ppp1r7 | NP_075689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | ||
LRR 1 | 78..99 | 4/20 (20%) | |||
LRR_4 | 99..140 | CDD:289563 | 10/44 (23%) | ||
LRR 2 | 100..121 | 2/22 (9%) | |||
leucine-rich repeat | 101..122 | CDD:275380 | 3/22 (14%) | ||
LRR_4 | 121..163 | CDD:289563 | 14/48 (29%) | ||
LRR_8 | 122..177 | CDD:290566 | 19/82 (23%) | ||
LRR 3 | 122..143 | 6/22 (27%) | |||
leucine-rich repeat | 123..144 | CDD:275380 | 6/22 (27%) | ||
LRR_4 | 143..185 | CDD:289563 | 15/69 (22%) | ||
LRR 4 | 144..165 | 7/25 (28%) | |||
leucine-rich repeat | 145..166 | CDD:275380 | 9/46 (20%) | ||
LRR_8 | 165..221 | CDD:290566 | 19/80 (24%) | ||
LRR 5 | 166..187 | 6/22 (27%) | |||
leucine-rich repeat | 167..188 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 188..227 | CDD:289563 | 13/42 (31%) | ||
LRR 6 | 188..209 | 6/22 (27%) | |||
leucine-rich repeat | 189..210 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 209..251 | CDD:289563 | 14/45 (31%) | ||
LRR 7 | 210..231 | 6/22 (27%) | |||
leucine-rich repeat | 211..232 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 231..287 | CDD:290566 | 21/59 (36%) | ||
LRR 8 | 232..253 | 7/22 (32%) | |||
leucine-rich repeat | 233..254 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 254..295 | CDD:289563 | 14/44 (32%) | ||
LRR 9 | 254..275 | 8/22 (36%) | |||
leucine-rich repeat | 255..276 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 276..317 | CDD:289563 | 13/50 (26%) | ||
LRR 10 | 276..297 | 6/22 (27%) | |||
leucine-rich repeat | 277..298 | CDD:275380 | 7/22 (32%) | ||
LRR 11 | 298..319 | 6/28 (21%) | |||
LRRcap | 337..355 | CDD:197729 | 1/1 (100%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |