DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LINGO3

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:394 Identity:115/394 - (29%)
Similarity:176/394 - (44%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLD 218
            |.|...|::..|....|.:||  ..||.....::||||.:..|:......|..|:|||:|.|.:.
Human    29 CECTVQTRAVACTRRRLTAVP--DGIPAETRLLELSRNRIRCLNPGDLAALPALEELDLSENAIA 91

  Fly   219 FLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVIN 283
            .:....|.:|..|.|||::.|||:.|....|.:|.||.:||||:|::.:|.:..|.....|..:.
Human    92 HVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLE 156

  Fly   284 MCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGL 348
            :.||.:...........|.||||.:.|..::.||..|:.:|..|..|......||.::|..|..|
Human   157 VGDNDLVFVSRRAFAGLLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRL 221

  Fly   349 RSLRTLSLHNNRI------SSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQN 407
            ..|..|.:.|..:      .||.|      .||.:|.:|...|:.:...|.....:|..|.|..|
Human   222 PGLLHLEIDNWPLLEEVAAGSLRG------LNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHN 280

  Fly   408 SMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLE 472
            .:|::|...|.::..|..|.|....|..:|...|.||..:::|.|:||:|...:...|..::.||
Human   281 PISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLE 345

  Fly   473 KLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPG 537
            .||:|.                        ||..||||.|::.:  |...|. :||:.|.|..|.
Human   346 TLRVDG------------------------NPLACDCRLLWIVQ--RRKTLN-FDGRLPACATPA 383

  Fly   538 DLGG 541
            ::.|
Human   384 EVRG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914 76/257 (30%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 10/22 (45%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
leucine-rich repeat 303..326 CDD:275380 9/22 (41%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
leucine-rich repeat 351..374 CDD:275380 6/28 (21%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
PCC 476..>561 CDD:188093 16/66 (24%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 9/30 (30%)
LRR 54..>303 CDD:443914 75/254 (30%)
LRR 1 55..76 5/20 (25%)
leucine-rich repeat 59..79 CDD:275380 6/19 (32%)
LRR 2 79..100 7/20 (35%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
LRR 3 103..124 9/20 (45%)
leucine-rich repeat 104..127 CDD:275380 10/22 (45%)
LRR 4 127..148 9/20 (45%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
LRR 5 151..172 3/20 (15%)
leucine-rich repeat 152..199 CDD:275380 13/46 (28%)
LRR 6 175..196 8/20 (40%)
leucine-rich repeat 200..223 CDD:275380 7/22 (32%)
LRR 7 207..228 6/20 (30%)
leucine-rich repeat 224..247 CDD:275380 6/28 (21%)
LRR 8 247..268 6/20 (30%)
leucine-rich repeat 248..271 CDD:275380 5/22 (23%)
LRR 9 271..292 7/20 (35%)
leucine-rich repeat 272..293 CDD:275380 7/20 (35%)
LRR 10 295..316 6/20 (30%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR 11 319..340 6/20 (30%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
PCC 334..>406 CDD:188093 21/81 (26%)
Ig 408..497 CDD:472250
Ig strand B 425..429 CDD:409353
Ig strand C 438..442 CDD:409353
Ig strand E 463..467 CDD:409353
Ig strand F 477..482 CDD:409353
Ig strand G 490..493 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.