DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LINGO3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:394 Identity:115/394 - (29%)
Similarity:176/394 - (44%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLD 218
            |.|...|::..|....|.:||  ..||.....::||||.:..|:......|..|:|||:|.|.:.
Human    29 CECTVQTRAVACTRRRLTAVP--DGIPAETRLLELSRNRIRCLNPGDLAALPALEELDLSENAIA 91

  Fly   219 FLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVIN 283
            .:....|.:|..|.|||::.|||:.|....|.:|.||.:||||:|::.:|.:..|.....|..:.
Human    92 HVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLE 156

  Fly   284 MCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGL 348
            :.||.:...........|.||||.:.|..::.||..|:.:|..|..|......||.::|..|..|
Human   157 VGDNDLVFVSRRAFAGLLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRL 221

  Fly   349 RSLRTLSLHNNRI------SSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQN 407
            ..|..|.:.|..:      .||.|      .||.:|.:|...|:.:...|.....:|..|.|..|
Human   222 PGLLHLEIDNWPLLEEVAAGSLRG------LNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHN 280

  Fly   408 SMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLE 472
            .:|::|...|.::..|..|.|....|..:|...|.||..:::|.|:||:|...:...|..::.||
Human   281 PISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLE 345

  Fly   473 KLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPG 537
            .||:|.                        ||..||||.|::.:  |...|. :||:.|.|..|.
Human   346 TLRVDG------------------------NPLACDCRLLWIVQ--RRKTLN-FDGRLPACATPA 383

  Fly   538 DLGG 541
            ::.|
Human   384 EVRG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 19/58 (33%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 58/190 (31%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 10/22 (45%)
LRR_8 253..313 CDD:290566 18/59 (31%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
LRR_8 303..361 CDD:290566 19/57 (33%)
leucine-rich repeat 303..326 CDD:275380 9/22 (41%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
LRR_8 349..407 CDD:290566 15/63 (24%)
LRR_4 350..390 CDD:289563 11/45 (24%)
leucine-rich repeat 351..374 CDD:275380 6/28 (21%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
LRR_8 398..>443 CDD:290566 13/44 (30%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
LRRCT 503..554 CDD:214507 15/39 (38%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 9/30 (30%)
LRR 1 55..76 5/20 (25%)
LRR_8 57..138 CDD:290566 31/80 (39%)
LRR_4 59..95 CDD:289563 12/35 (34%)
leucine-rich repeat 59..79 CDD:275380 6/19 (32%)
LRR 2 79..100 7/20 (35%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
LRR 3 103..124 9/20 (45%)
leucine-rich repeat 104..127 CDD:275380 10/22 (45%)
LRR_RI 111..>286 CDD:238064 52/180 (29%)
LRR_8 127..>172 CDD:290566 12/44 (27%)
LRR 4 127..148 9/20 (45%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
LRR 5 151..172 3/20 (15%)
leucine-rich repeat 152..199 CDD:275380 13/46 (28%)
LRR 6 175..196 8/20 (40%)
LRR_8 198..258 CDD:290566 17/65 (26%)
leucine-rich repeat 200..223 CDD:275380 7/22 (32%)
LRR 7 207..228 6/20 (30%)
leucine-rich repeat 224..247 CDD:275380 6/28 (21%)
LRR_8 247..303 CDD:290566 16/55 (29%)
LRR 8 247..268 6/20 (30%)
leucine-rich repeat 248..271 CDD:275380 5/22 (23%)
LRR 9 271..292 7/20 (35%)
leucine-rich repeat 272..293 CDD:275380 7/20 (35%)
LRR 10 295..316 6/20 (30%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR 11 319..340 6/20 (30%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
I-set 407..497 CDD:254352
Ig 422..490 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6410
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.