DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and NYX

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001365406.2 Gene:NYX / 60506 HGNCID:8082 Length:476 Species:Homo sapiens


Alignment Length:454 Identity:120/454 - (26%)
Similarity:184/454 - (40%) Gaps:95/454 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPDTK--SFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNV 216
            |.|:...:  |..|....|..||..  :|...|:|||.||.|..|.:..|..|..|:.|.:.||.
Human    30 CACSTVERGCSVRCDRAGLLRVPAE--LPCEAVSIDLDRNGLRFLGERAFGTLPSLRRLSLRHNN 92

  Fly   217 LDFLPFDLFQDLDSLLVLRI-QNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLT 280
            |.|:....|:.|..|..||: .|..|..:..|||..|..|..|||:...:..:||.:......|.
Human    93 LSFITPGAFKGLPRLAELRLAHNGDLRYLHARTFAALSRLRRLDLAACRLFSVPERLLAELPALR 157

  Fly   281 VINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFF 345
            .:...||..:.. |..||....|....:.|.:|..::|.|::                       
Human   158 ELAAFDNLFRRV-PGALRGLANLTHAHLERGRIEAVASSSLQ----------------------- 198

  Fly   346 AGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMS 410
             |||.||:|||..||:.::....|.:...|..|.|..|.::.:..:||..|..|..|.||.|::.
Human   199 -GLRRLRSLSLQANRVRAVHAGAFGDCGVLEHLLLNDNLLAELPADAFRGLRRLRTLNLGGNALD 262

  Fly   411 SIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLR 475
            .:....|.:::.|..|.|..|::..:|...||.|:.|..|.||.|.|......||:|...|.:| 
Human   263 RVARAWFADLAELELLYLDRNSIAFVEEGAFQNLSGLLALHLNGNRLTVLAWVAFQPGFFLGRL- 326

  Fly   476 IDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPM----CRGP 536
                 .:|                  :|||.||||    ..|:|:::    :|...:    |..|
Human   327 -----FLF------------------RNPWCCDCR----LEWLRDWM----EGSGRVTDVPCASP 360

  Fly   537 GDLGGHEVGLLRYDDLCDG---------------------------QWASMLS--LSPRLPVRK 571
            |.:.|.::..:.:....||                           :::|:||  |:||:||.:
Human   361 GSVAGLDLSQVTFGRSSDGLCVDPEELNLTTSSPGPSPEPAATTVSRFSSLLSKLLAPRVPVEE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 22/59 (37%)
leucine-rich repeat 187..206 CDD:275380 8/18 (44%)
LRR_RI <201..386 CDD:238064 51/185 (28%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 9/23 (39%)
LRR_8 253..313 CDD:290566 14/59 (24%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 303..361 CDD:290566 14/57 (25%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 20/57 (35%)
LRR_4 350..390 CDD:289563 12/39 (31%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 12/44 (27%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 3/22 (14%)
LRRCT 503..554 CDD:214507 14/54 (26%)
NYXNP_001365406.2 LRR_8 61..115 CDD:404697 20/53 (38%)
leucine-rich repeat 63..82 CDD:275380 8/18 (44%)
leucine-rich repeat 83..106 CDD:275380 8/22 (36%)
leucine-rich repeat 107..131 CDD:275380 9/23 (39%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
PPP1R42 150..310 CDD:411060 48/184 (26%)
leucine-rich repeat 156..178 CDD:275380 6/22 (27%)
leucine-rich repeat 179..202 CDD:275380 7/46 (15%)
leucine-rich repeat 203..226 CDD:275380 8/22 (36%)
LRR_8 227..285 CDD:404697 17/57 (30%)
leucine-rich repeat 227..250 CDD:275380 7/22 (32%)
leucine-rich repeat 251..274 CDD:275380 6/22 (27%)
leucine-rich repeat 275..296 CDD:275380 7/20 (35%)
leucine-rich repeat 323..335 CDD:275378 6/35 (17%)
LRRCT 331..>365 CDD:214507 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.