DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LGR6

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001017403.1 Gene:LGR6 / 59352 HGNCID:19719 Length:967 Species:Homo sapiens


Alignment Length:441 Identity:121/441 - (27%)
Similarity:177/441 - (40%) Gaps:61/441 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPD--TKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNV 216
            |.|..|  ..|..|....|.:|| ..:.|:. ..:|||.|.|:.|....|..|..|:||.:|.|.
Human    39 CHCQEDGIMLSADCSELGLSAVP-GDLDPLT-AYLDLSMNNLTELQPGLFHHLRFLEELRLSGNH 101

  Fly   217 LDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTV 281
            |..:|...|..|.||.:|.:|||||..|.....|:|.:|..|.|..|.|.::||..|.....|..
Human   102 LSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRH 166

  Fly   282 INMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFA 346
            :.:.||.:...|...|.:                        |..|:.:....|:|:.|.|..|.
Human   167 LWLDDNALTEIPVRALNN------------------------LPALQAMTLALNRISHIPDYAFQ 207

  Fly   347 GLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSS 411
            .|.||..|.||||||..|....|..|.||.||||..|::.... .|...|..|.||....|::.:
Human   208 NLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFP-VAIRTLGRLQELGFHNNNIKA 271

  Fly   412 IPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPL---SQLEK 473
            ||...|:....|..:..:.|.:..:....||.|..|..|.||..:    |.:.|..|   :.||.
Human   272 IPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAM----DIQEFPDLKGTTSLEI 332

  Fly   474 LRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVL---KLWDGQQPMCRG 535
            |.:....:..||.|....|..|..::|..|... :..:|:..:.:.|..|   ::|         
Human   333 LTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIE-ELPSLHRCQKLEEIGLQHNRIW--------- 387

  Fly   536 PGDLGGHEVGLLRYDDLCDGQWASMLSLSP----------RLPVRKHQIST 576
              ::|......|......|..|.::.|:.|          :|.:..:|::|
Human   388 --EIGADTFSQLSSLQALDLSWNAIRSIHPEAFSTLHSLVKLDLTDNQLTT 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914 79/251 (31%)
leucine-rich repeat 187..206 CDD:275380 8/18 (44%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 10/22 (45%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
leucine-rich repeat 303..326 CDD:275380 1/22 (5%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
leucine-rich repeat 351..374 CDD:275380 11/22 (50%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 3/19 (16%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
PCC 476..>561 CDD:188093 15/87 (17%)
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470 9/29 (31%)
LRR <70..>293 CDD:443914 79/247 (32%)
leucine-rich repeat 70..91 CDD:275380 8/20 (40%)
LRR 1 91..112 8/20 (40%)
leucine-rich repeat 92..115 CDD:275380 9/22 (41%)
LRR 2 115..136 9/20 (45%)
leucine-rich repeat 116..139 CDD:275380 10/22 (45%)
LRR 3 139..160 8/20 (40%)
leucine-rich repeat 140..163 CDD:275380 8/22 (36%)
LRR 4 163..186 5/46 (11%)
leucine-rich repeat 164..187 CDD:275380 6/46 (13%)
LRR 5 187..208 6/20 (30%)
leucine-rich repeat 188..211 CDD:275380 7/22 (32%)
LRR 6 211..232 11/20 (55%)
leucine-rich repeat 212..235 CDD:275380 11/22 (50%)
LRR 7 235..256 8/21 (38%)
leucine-rich repeat 236..258 CDD:275380 8/22 (36%)
LRR 8 258..279 7/20 (35%)
leucine-rich repeat 259..282 CDD:275380 7/22 (32%)
LRR_8 281..364 CDD:404697 22/86 (26%)
LRR 9 282..303 3/20 (15%)
leucine-rich repeat 283..304 CDD:275380 4/20 (20%)
LRR 10 306..328 7/25 (28%)
LRR 11 329..350 6/20 (30%)
leucine-rich repeat 330..344 CDD:275378 3/13 (23%)
LRR <349..>473 CDD:443914 17/100 (17%)
LRR 12 353..374 4/21 (19%)
leucine-rich repeat 354..399 CDD:275380 9/56 (16%)
LRR 13 375..396 4/31 (13%)
leucine-rich repeat 376..390 CDD:275378 3/24 (13%)
LRR 14 399..420 4/20 (20%)
leucine-rich repeat 400..423 CDD:275380 4/22 (18%)
LRR 15 423..443 3/14 (21%)
leucine-rich repeat 424..444 CDD:275380 3/13 (23%)
7tmA_LGR6 562..834 CDD:320484
TM helix 1 563..589 CDD:320484
TM helix 2 597..622 CDD:320484
TM helix 3 642..672 CDD:320484
TM helix 4 684..706 CDD:320484
TM helix 5 728..757 CDD:320484
TM helix 6 766..796 CDD:320484
TM helix 7 806..831 CDD:320484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.