DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LRRC7

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001357714.1 Gene:LRRC7 / 57554 HGNCID:18531 Length:1575 Species:Homo sapiens


Alignment Length:422 Identity:107/422 - (25%)
Similarity:175/422 - (41%) Gaps:72/422 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVN--- 185
            :|:.:|....|.:..:...::.      ...|..|: :...|.....|...:.:::|.....   
Human     2 MENLIRGRNPPQYQRSPCKEVR------AALRKRPE-EELQCLEMTTKRKIIGRLVPCRCFRGEE 59

  Fly   186 -----IDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDID 245
                 :|.|...|..:.|:.|.....|:||.:..|.::.||..|| :..:|..|.|.:|.|.::.
Human    60 EIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLF-NCQALRKLSIPDNDLSNLP 123

  Fly   246 HRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLR----DQLMLEE- 305
             .|...|.||..||:|||.:...||:| ...:.||:|....|.|...|....:    .||.|.: 
Human   124 -TTIASLVNLKELDISKNGVQEFPENI-KCCKCLTIIEASVNPISKLPDGFTQLLNLTQLYLNDA 186

  Fly   306 -----------------LDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRT 353
                             |::..|.:..|.. |:..|.:|:.||.|.|:..:: .:....:::||.
Human   187 FLEFLPANFGRLVKLRILELRENHLKTLPK-SMHKLAQLERLDLGNNEFGEL-PEVLDQIQNLRE 249

  Fly   354 LSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNN---LNELFLGQNSMSSIPAD 415
            |.:.||.:..|.|:| ..|..||.||::.|||..:|    ::::.   |.:|.|..|.:..:|..
Human   250 LWMDNNALQVLPGSI-GKLKMLVYLDMSKNRIETVD----MDISGCEALEDLLLSSNMLQQLPDS 309

  Fly   416 LFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFE----P-----LSQL 471
            :.|           ...||||:.||.| |..|...:.|.::|:.||....|    |     |..|
Human   310 IGL-----------LKKLTTLKVDDNQ-LTMLPNTIGNLSLLEEFDCSCNELESLPSTIGYLHSL 362

  Fly   472 EKLRIDSNKLMFLPHGALHGLKNLVAVKLDKN 503
            ..|.:|.|.|..||. .:...||:..:.|..|
Human   363 RTLAVDENFLPELPR-EIGSCKNVTVMSLRSN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 17/66 (26%)
leucine-rich repeat 187..206 CDD:275380 5/18 (28%)
LRR_RI <201..386 CDD:238064 60/206 (29%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 21/81 (26%)
leucine-rich repeat 255..278 CDD:275380 9/22 (41%)
leucine-rich repeat 279..302 CDD:275380 7/26 (27%)
LRR_8 303..361 CDD:290566 16/75 (21%)
leucine-rich repeat 303..326 CDD:275380 6/40 (15%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 20/60 (33%)
LRR_4 350..390 CDD:289563 16/39 (41%)
leucine-rich repeat 351..374 CDD:275380 9/22 (41%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
LRR_8 398..>443 CDD:290566 12/47 (26%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
LRRCT 503..554 CDD:214507 1/1 (100%)
LRRC7NP_001357714.1 leucine-rich repeat 64..85 CDD:275380 5/20 (25%)
LRR_8 85..140 CDD:338972 20/56 (36%)
leucine-rich repeat 86..108 CDD:275380 8/22 (36%)
leucine-rich repeat 109..131 CDD:275380 7/22 (32%)
LRR 130..440 CDD:227223 79/285 (28%)
leucine-rich repeat 132..177 CDD:275380 15/45 (33%)
leucine-rich repeat 178..200 CDD:275380 3/21 (14%)
leucine-rich repeat 201..223 CDD:275380 5/22 (23%)
leucine-rich repeat 224..246 CDD:275380 5/22 (23%)
leucine-rich repeat 247..269 CDD:275380 9/22 (41%)
leucine-rich repeat 270..292 CDD:275380 8/25 (32%)
leucine-rich repeat 316..336 CDD:275380 9/20 (45%)
leucine-rich repeat 339..361 CDD:275380 6/21 (29%)
leucine-rich repeat 362..384 CDD:275380 7/22 (32%)
leucine-rich repeat 385..407 CDD:275380 2/9 (22%)
leucine-rich repeat 408..430 CDD:275380
PDZ_signaling 1485..1570 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.