DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Lgr4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001285192.1 Gene:Lgr4 / 5740505 FlyBaseID:FBgn0085440 Length:809 Species:Drosophila melanogaster


Alignment Length:481 Identity:120/481 - (24%)
Similarity:189/481 - (39%) Gaps:108/481 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NACESLGIVSQLLMLINSMPNGTQS-----AANDK--------------KPPKSKANGHNDGDVN 102
            :|.|:...|.:::.|:..: :|.:|     .|:||              .|.::..:|..|.|..
  Fly    55 DATEAEAPVREVISLLGII-DGAESDILVPDADDKCPGGYFHCNTTAQCVPQRANCDGSVDCDDA 118

  Fly   103 GGEINAMSHL--ANFDLVKRVRQIESRLRSVEQPVW---HLATGSQIEWNHCTSGVCRCNPDTKS 162
            ..|:|.::.:  ..:|.:.|           :||..   :|..|..:..|...|  |.|..|  .
  Fly   119 SDEVNCVNEVDAKYWDHLYR-----------KQPFGRHDNLRIGECLWPNENFS--CPCRGD--E 168

  Fly   163 FTCWNTNLKSVPVTQVIPM-NMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQ 226
            ..|....|..:|  :.:|. ::..:||:.|...|:| :||                    |....
  Fly   169 ILCRFQQLTDIP--ERLPQHDLATLDLTGNNFETIH-ETF--------------------FSELP 210

  Fly   227 DLDSLLVLRIQNNQLEDIDHRTFWKLRN--LNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQI 289
            |:|| |||:..:  :.:|....|.:|.:  |..|.:..|::..|||..|....:|::        
  Fly   211 DVDS-LVLKFCS--IREIASHAFDRLADNPLRTLYMDDNKLPHLPEHFFPEGNQLSI-------- 264

  Fly   290 QNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTL 354
                            |.::||.:..|.......|.||:.||...|:|...:.:.||.|.:|..|
  Fly   265 ----------------LILARNHLHHLKRSDFLNLQKLQELDLRGNRIGNFEAEVFARLPNLEVL 313

  Fly   355 SLHNNRISSLSGTIF-NNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFL 418
            .|:.|.:..|....| ..|.||.||.|..|:|..|..|.| ....|..|||..|.:|.|..:.|.
  Fly   314 YLNENHLKRLDPDRFPRTLLNLHTLSLAYNQIEDIAANTF-PFPRLRYLFLAGNRLSHIRDETFC 377

  Fly   419 NVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRID------ 477
            |:|.|..|.|..|.:...:.:.|..|.||..|||..|..:..|:|..:.|:.|:.:...      
  Fly   378 NLSNLQGLHLNENRIEGFDLEAFACLKNLSSLLLTGNRFQTLDSRVLKNLTSLDYIYFSWFHLCS 442

  Fly   478 --SNKLMFLPHG-----ALHGLKNLV 496
              .|..:..|||     .||.|.|.:
  Fly   443 AAMNVRVCDPHGDGISSKLHLLDNQI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 14/58 (24%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 46/187 (25%)
leucine-rich repeat 207..230 CDD:275380 2/22 (9%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 11/61 (18%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 1/22 (5%)
LRR_8 303..361 CDD:290566 18/57 (32%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
LRR_8 349..407 CDD:290566 21/58 (36%)
LRR_4 350..390 CDD:289563 15/40 (38%)
leucine-rich repeat 351..374 CDD:275380 7/23 (30%)
leucine-rich repeat 375..398 CDD:275380 9/22 (41%)
LRR_8 398..>443 CDD:290566 15/44 (34%)
leucine-rich repeat 399..422 CDD:275380 9/22 (41%)
leucine-rich repeat 423..443 CDD:275380 5/19 (26%)
leucine-rich repeat 471..494 CDD:275380 8/35 (23%)
LRRCT 503..554 CDD:214507
Lgr4NP_001285192.1 Ldl_recept_a 87..124 CDD:278486 7/36 (19%)
LRR_RI <184..397 CDD:238064 71/261 (27%)
LRR_8 188..248 CDD:290566 20/83 (24%)
leucine-rich repeat 188..211 CDD:275380 8/43 (19%)
leucine-rich repeat 212..235 CDD:275380 8/25 (32%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
LRR_8 261..320 CDD:290566 19/82 (23%)
leucine-rich repeat 262..285 CDD:275380 6/46 (13%)
LRR_4 284..325 CDD:289563 14/40 (35%)
leucine-rich repeat 286..309 CDD:275380 8/22 (36%)
LRR_4 308..348 CDD:289563 14/39 (36%)
leucine-rich repeat 310..334 CDD:275380 7/23 (30%)
leucine-rich repeat 335..357 CDD:275380 9/22 (41%)
LRR_8 356..416 CDD:290566 22/59 (37%)
leucine-rich repeat 358..381 CDD:275380 9/22 (41%)
LRR_4 381..421 CDD:289563 12/39 (31%)
leucine-rich repeat 382..405 CDD:275380 6/22 (27%)
leucine-rich repeat 406..427 CDD:275380 7/20 (35%)
7tm_1 483..741 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.