DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and rxfp2b

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001315011.1 Gene:rxfp2b / 566888 ZFINID:ZDB-GENE-110408-27 Length:750 Species:Danio rerio


Alignment Length:438 Identity:107/438 - (24%)
Similarity:169/438 - (38%) Gaps:127/438 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NDKKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKRVRQIESRLRSVEQPVWHLATGSQIEWNH 148
            |::|...:.|:..|.||.:|..          ||..|..:     |...|   .|||..|:|.  
Zfish    60 NNQKDCPNGADEDNCGDNSGWA----------DLFDRTFK-----RGYLQ---ELATDCQVEQ-- 104

  Fly   149 CTSGVCRC-NPDTKSFTCWNTNLKSVP-----VT---------QVIP-------MNMVNIDLSRN 191
             ...|||| |.:   ..|.:.:|:|:|     ||         :.:|       :.:..:.|..|
Zfish   105 -YPDVCRCINTE---IHCVHASLRSIPQVSANVTSLSLKSNKIRTLPDEAFIKYIKLQRLFLQDN 165

  Fly   192 ILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRN-- 254
            .::|:....|.||..|::|.:|.|.:..|...:|:||..|..|.:.:|.:..|...||..|.:  
Zfish   166 CINTVSIQAFSGLYKLQKLSLSQNSISLLSPGVFRDLRKLKWLILDDNPITTIAANTFAGLSSLF 230

  Fly   255 -----------------------LNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNL 296
                                   |:.||...|.|..|..|.....:.|||:::..|.|::.|.|.
Zfish   231 FLSMVNTSLEALPSARLCAHMPFLSWLDFEGNSITTLGLSTLLDCEHLTVLSLRANLIKSLPENT 295

  Fly   297 LRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRI 361
            .:...|:.:||:|.|.|.||..|                        .|..||||::|:|..|.:
Zfish   296 FQSLRMMGDLDLSNNSIKELPVG------------------------IFKDLRSLQSLNLSQNPL 336

  Fly   362 SSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFL--------------------GQ 406
            ..:....||:|..|.:|.|....|.:|..:.|..::||:.::.                    |.
Zfish   337 DHIHPGQFNHLIQLQSLGLEGVEIPNIQTSMFRPMDNLSYIYFKKFQYCSYAPHVRKCKPNSDGL 401

  Fly   407 NSMSSIPADLFLNVS--ALTRLTLFSNNL-----TTLEADDFQGLNNL 447
            :|...:.|::.|.||  .:..:|.|.|..     |.|.|:     |||
Zfish   402 SSFEDLLANVVLRVSVWVMAFITCFGNLFVIGMRTVLRAE-----NNL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 17/58 (29%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 55/209 (26%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 19/84 (23%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
LRR_8 303..361 CDD:290566 16/57 (28%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 18/77 (23%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 14/71 (20%)
leucine-rich repeat 399..422 CDD:275380 7/44 (16%)
leucine-rich repeat 423..443 CDD:275380 6/24 (25%)
leucine-rich repeat 471..494 CDD:275380
LRRCT 503..554 CDD:214507
rxfp2bNP_001315011.1 LDLa 39..74 CDD:238060 3/13 (23%)
leucine-rich repeat 114..132 CDD:275380 4/20 (20%)
LRR_RI 130..360 CDD:238064 61/253 (24%)
leucine-rich repeat 133..156 CDD:275380 3/22 (14%)
LRR_8 156..215 CDD:290566 17/58 (29%)
leucine-rich repeat 157..180 CDD:275380 6/22 (27%)
leucine-rich repeat 181..204 CDD:275380 8/22 (36%)
LRR_8 203..288 CDD:290566 18/84 (21%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..253 CDD:275380 0/23 (0%)
leucine-rich repeat 254..277 CDD:275380 7/22 (32%)
LRR_8 277..336 CDD:290566 24/82 (29%)
leucine-rich repeat 278..301 CDD:275380 7/22 (32%)
leucine-rich repeat 302..325 CDD:275380 10/46 (22%)
LRR_8 324..378 CDD:290566 17/53 (32%)
leucine-rich repeat 326..349 CDD:275380 7/22 (32%)
leucine-rich repeat 350..369 CDD:275380 5/18 (28%)
7tm_4 419..>556 CDD:304433 9/31 (29%)
7tm_1 <487..686 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.