| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005166545.1 | Gene: | lrrc4cb / 564462 | ZFINID: | ZDB-GENE-080327-5 | Length: | 631 | Species: | Danio rerio |
| Alignment Length: | 349 | Identity: | 103/349 - (29%) |
|---|---|---|---|
| Similarity: | 148/349 - (42%) | Gaps: | 66/349 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 282 INMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFA 346
Fly 347 GLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDL-TTNRISHIDGNAFVELNNLNELFLGQNSMS 410
Fly 411 SIPADLFLNVSALTR---LTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLE 472
Fly 473 KLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQP------ 531
Fly 532 -MCRGPGDLGGHEVGLLRYDDLCDGQWASMLSLSPRLPVRKHQISTPMNYTDYFNLYLKHIYNGT 595
Fly 596 TDEELKEA----------DITSVS 609 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 37/104 (36%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 12/30 (40%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 6/19 (32%) | ||
| LRR_8 | 303..361 | CDD:290566 | 22/57 (39%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 349..407 | CDD:290566 | 24/58 (41%) | ||
| LRR_4 | 350..390 | CDD:289563 | 16/40 (40%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 10/23 (43%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 14/47 (30%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 503..554 | CDD:214507 | 18/57 (32%) | ||
| lrrc4cb | XP_005166545.1 | LRRNT | 48..81 | CDD:214470 | |
| LRR_8 | 77..137 | CDD:290566 | 20/54 (37%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 6/19 (32%) | ||
| LRR_RI | 82..>281 | CDD:238064 | 65/203 (32%) | ||
| leucine-rich repeat | 103..126 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 125..180 | CDD:290566 | 19/54 (35%) | ||
| leucine-rich repeat | 127..150 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 151..174 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 175..199 | CDD:275380 | 10/23 (43%) | ||
| leucine-rich repeat | 200..221 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 221..280 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 222..245 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 246..269 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 270..291 | CDD:275380 | 8/20 (40%) | ||
| LRRCT | 302..352 | CDD:214507 | 20/89 (22%) | ||
| I-set | 355..443 | CDD:254352 | 8/31 (26%) | ||
| Ig | 372..439 | CDD:143165 | 4/14 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1378 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||