Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001920877.1 | Gene: | si:ch211-237i5.4 / 557635 | ZFINID: | ZDB-GENE-131121-468 | Length: | 346 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 72/263 - (27%) |
---|---|---|---|
Similarity: | 115/263 - (43%) | Gaps: | 31/263 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 LDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFV 394
Fly 395 ELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLK----------- 448
Fly 449 -------------ILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVA-VK 499
Fly 500 LDKNPWHCDC---RALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDDLCDGQWASML 561
Fly 562 SLS 564 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
leucine-rich repeat | 187..206 | CDD:275380 | |||
LRR_RI | <201..386 | CDD:238064 | 22/55 (40%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | |||
leucine-rich repeat | 231..254 | CDD:275380 | |||
LRR_8 | 253..313 | CDD:290566 | |||
leucine-rich repeat | 255..278 | CDD:275380 | |||
leucine-rich repeat | 279..302 | CDD:275380 | |||
LRR_8 | 303..361 | CDD:290566 | 14/30 (47%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | |||
leucine-rich repeat | 327..350 | CDD:275380 | 9/19 (47%) | ||
LRR_8 | 349..407 | CDD:290566 | 20/57 (35%) | ||
LRR_4 | 350..390 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 351..374 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 375..398 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 398..>443 | CDD:290566 | 12/44 (27%) | ||
leucine-rich repeat | 399..422 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 423..443 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 471..494 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 503..554 | CDD:214507 | 16/53 (30%) | ||
si:ch211-237i5.4 | XP_001920877.1 | leucine-rich repeat | 34..53 | CDD:275380 | |
leucine-rich repeat | 54..75 | CDD:275380 | 9/19 (47%) | ||
LRR_RI | <69..238 | CDD:238064 | 47/168 (28%) | ||
LRR_8 | 75..134 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 122..182 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 170..230 | CDD:290566 | 11/59 (19%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 220..240 | CDD:275380 | 5/19 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |