DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and si:ch211-237i5.4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_001920877.1 Gene:si:ch211-237i5.4 / 557635 ZFINID:ZDB-GENE-131121-468 Length:346 Species:Danio rerio


Alignment Length:263 Identity:72/263 - (27%)
Similarity:115/263 - (43%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFV 394
            ||.|.|::.:|....||||.|||.|.|.::.|.:|....|.:|:.|..||::.|.::.|..|...
Zfish    55 LDLGGNRLTEIRSRAFAGLWSLRILVLSDSNIQALQSQAFFSLSFLEKLDMSHNNLTQIPPNFSE 119

  Fly   395 ELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLK----------- 448
            .|::|.||.|..|::..:......::..|.:|.|..|::.:||...|:||:.|:           
Zfish   120 SLSSLRELRLDHNALQLLKPPGLEHLENLAKLDLSHNHIQSLEPGAFRGLSRLRHLYLQGNHLDV 184

  Fly   449 -------------ILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVA-VK 499
                         :|.|.||.:...:..|..||..|..|.::.|:|..|.......|:.... :.
Zfish   185 IRDRSLTMLPALEVLQLGNNNISQIEVNALAPLHSLSLLGLEGNQLEHLNFKTFLSLRTATTHLL 249

  Fly   500 LDKNPWHCDC---RALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDDLCDGQWASML 561
            |..|||.|||   |.......:|.  |.:.|.....||.|..|.|..:..:. ..||..:..::|
Zfish   250 LSGNPWSCDCDLHRVFSKLLSVRH--LHVDDYHNVTCREPWQLAGASLAWVD-SQLCVAETVTVL 311

  Fly   562 SLS 564
            .::
Zfish   312 VIT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 22/55 (40%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566 14/30 (47%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 9/19 (47%)
LRR_8 349..407 CDD:290566 20/57 (35%)
LRR_4 350..390 CDD:289563 14/39 (36%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 12/44 (27%)
leucine-rich repeat 399..422 CDD:275380 5/22 (23%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 6/22 (27%)
LRRCT 503..554 CDD:214507 16/53 (30%)
si:ch211-237i5.4XP_001920877.1 leucine-rich repeat 34..53 CDD:275380
leucine-rich repeat 54..75 CDD:275380 9/19 (47%)
LRR_RI <69..238 CDD:238064 47/168 (28%)
LRR_8 75..134 CDD:290566 21/58 (36%)
leucine-rich repeat 76..99 CDD:275380 8/22 (36%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 15/59 (25%)
leucine-rich repeat 124..147 CDD:275380 5/22 (23%)
leucine-rich repeat 148..171 CDD:275380 9/22 (41%)
LRR_8 170..230 CDD:290566 11/59 (19%)
leucine-rich repeat 172..195 CDD:275380 1/22 (5%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..240 CDD:275380 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.