DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP005668

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_001237694.1 Gene:AgaP_AGAP005668 / 4576765 VectorBaseID:AGAP005668 Length:405 Species:Anopheles gambiae


Alignment Length:412 Identity:87/412 - (21%)
Similarity:159/412 - (38%) Gaps:117/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILS----TLHKDTFRGLTVLKELDISHNVLDF 219
            |..||      :||:.:....|:..:::..:...||    .|.:..|...:.||.|.|::..|..
Mosquito    71 DLPSF------VKSLYIQHATPLKWISVPQTLKALSIELTRLRRIEFEANSTLKHLMIAYCQLST 129

  Fly   220 LPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINM 284
            || |..|....||.|:|.:..::.:|                                   :.::
Mosquito   130 LP-DAIQHAPMLLHLQITSCNIQQLD-----------------------------------MASL 158

  Fly   285 CDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLT---KLKTLDFGWNQIAKIDDDFFA 346
            |:|             .:|..:.::|||:..:::.|.:...   .|..|....|::..|:.:.|.
Mosquito   159 CEN-------------ALLSTVILTRNKLRYIANTSTKQCALYDSLSALVLTGNRLKSINMELFN 210

  Fly   347 GLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHI---------------DGNAFVE- 395
            |...|.::.|.:|||:||:|...:|....:.:|:  ||::.:               |.|...| 
Mosquito   211 GFVRLDSVFLQSNRITSLAGRFVHNAIAELRMDI--NRLAWVDLCQWSVPALVWLSFDENVLAEV 273

  Fly   396 ------LNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNL--TTLEADDFQGLNNLKILLL 452
                  |.|:..|.|..|.:|:...:....:..|..|:|..|.|  .||.::.|.  ..|:.:.|
Mosquito   274 PKCMNNLKNITRLVLSSNVLSNFTIESVAGMEHLVSLSLSYNQLLSVTLNSERFP--RRLEFINL 336

  Fly   453 NNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLK-NLVAVKLDKNPWHCDCRALYLAR 516
            .:|.|.:.|. :|.|   :..|:||::: .|:....:||.. |:..:.::.||..|.        
Mosquito   337 YHNNLTSLDL-SFIP---VRSLKIDASR-NFIASFDVHGTSANVSRLAMEHNPIDCS-------- 388

  Fly   517 WIREFVLKLWD----GQQPMCR 534
                     ||    .:|..|:
Mosquito   389 ---------WDIDTKREQMQCK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 17/62 (27%)
leucine-rich repeat 187..206 CDD:275380 4/22 (18%)
LRR_RI <201..386 CDD:238064 40/187 (21%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 5/59 (8%)
leucine-rich repeat 255..278 CDD:275380 0/22 (0%)
leucine-rich repeat 279..302 CDD:275380 2/22 (9%)
LRR_8 303..361 CDD:290566 14/60 (23%)
leucine-rich repeat 303..326 CDD:275380 5/25 (20%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
LRR_8 349..407 CDD:290566 19/79 (24%)
LRR_4 350..390 CDD:289563 12/54 (22%)
leucine-rich repeat 351..374 CDD:275380 9/22 (41%)
leucine-rich repeat 375..398 CDD:275380 7/44 (16%)
LRR_8 398..>443 CDD:290566 13/46 (28%)
leucine-rich repeat 399..422 CDD:275380 4/22 (18%)
leucine-rich repeat 423..443 CDD:275380 8/21 (38%)
leucine-rich repeat 471..494 CDD:275380 6/23 (26%)
LRRCT 503..554 CDD:214507 7/36 (19%)
AgaP_AGAP005668XP_001237694.1 leucine-rich repeat 117..139 CDD:275380 9/22 (41%)
leucine-rich repeat 164..190 CDD:275380 5/25 (20%)
LRR_8 190..247 CDD:290566 17/58 (29%)
leucine-rich repeat 191..214 CDD:275380 6/22 (27%)
leucine-rich repeat 215..259 CDD:275380 12/45 (27%)
leucine-rich repeat 260..282 CDD:275380 4/21 (19%)
LRR_8 281..341 CDD:290566 16/61 (26%)
leucine-rich repeat 283..306 CDD:275380 4/22 (18%)
leucine-rich repeat 307..330 CDD:275380 8/24 (33%)
leucine-rich repeat 354..365 CDD:275378 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.